KEGG   Arabidopsis thaliana (thale cress): AT3G21180
Entry
AT3G21180         CDS       T00041                                 

Gene name
ACA9
Definition
(RefSeq) autoinhibited Ca(2+)-ATPase 9
  KO
K01537  P-type Ca2+ transporter type 2C [EC:7.2.2.10]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AT3G21180 (ACA9)
Enzymes [BR:ath01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     AT3G21180 (ACA9)
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Hydrolase CaATP_NAI Cation_ATPase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 821671
NCBI-ProteinID: NP_188755
TAIR: AT3G21180
UniProt: Q9LU41 A0A178VER8
Position
3
AA seq 1086 aa
MSTSSSNGLLLTSMSGRHDDMEAGSAKTEEHSDHEELQHDPDDPFDIDNTKNASVESLRR
WRQAALVLNASRRFRYTLDLNKEEHYDNRRRMIRAHAQVIRAALLFKLAGEQQIAFGSST
PAASTGNFDIDLEKLVSMTRNQNMSNLQQYGGVKGVAEKLKSNMEQGINEDEKEVIDRKN
AFGSNTYPKKKGKNFFMFLWEAWQDLTLIILIIAAVTSLALGIKTEGLKEGWLDGGSIAF
AVLLVIVVTAVSDYRQSLQFQNLNDEKRNIQLEVMRGGRTVKISIYDVVVGDVIPLRIGD
QVPADGVLISGHSLAIDESSMTGESKIVHKDQKSPFLMSGCKVADGVGNMLVTGVGINTE
WGLLMASISEDTGEETPLQVRLNGLATFIGIVGLSVALVVLVALLVRYFTGTTQDTNGAT
QFIKGTTSISDIVDDCVKIFTIAVTIVVVAVPEGLPLAVTLTLAYSMRKMMADKALVRRL
SACETMGSATTICSDKTGTLTLNQMTVVETYAGGSKMDVADNPSGLHPKLVALISEGVAQ
NTTGNIFHPKDGGEVEISGSPTEKAILSWAYKLGMKFDTIRSESAIIHAFPFNSEKKRGG
VAVLRGDSEVFIHWKGAAEIVLACCTQYMDSNGTLQSIESQKEFFRVAIDSMAKNSLRCV
AIACRTQELNQVPKEQEDLDKWALPEDELILLAIVGIKDPCRPGVREAVRICTSAGVKVR
MVTGDNLQTAKAIALECGILSSDTEAVEPTIIEGKVFRELSEKEREQVAKKITVMGRSSP
NDKLLLVQALRKNGDVVAVTGDGTNDAPALHEADIGLSMGISGTEVAKESSDIIILDDNF
ASVVKVVRWGRSVYANIQKFIQFQLTVNVAALIINVVAAMSSGDVPLKAVQLLWVNLIMD
TLGALALATEPPTDHLMHRTPVGRREPLITNIMWRNLLVQSFYQVAVLLVLNFAGLSILG
LNHENHAHAVEVKNTMIFNAFVMCQIFNEFNARKPDEMNVFRGVNKNPLFVAIVGVTFIL
QIIIVTFLGKFAHTVRLGWQLWLASIIIGLVSWPLAIVGKLIPVPKTPMSVYFKKPFRKY
KASRNA
NT seq 3261 nt   +upstreamnt  +downstreamnt
atgagcacttcgtcgagcaacggattgcttctgacgtcaatgtcaggacgtcatgacgac
atggaagctggttctgctaaaactgaagaacattctgatcatgaagagcttcaacatgat
cctgatgatccttttgatattgataacaccaagaacgcttctgttgaatctcttcgtcgt
tggagacaagccgctcttgtgttgaacgcatcgcgtcggtttcgatacactttggatctt
aataaagaagaacattatgataatcgaaggaggatgatcagagctcatgctcaagtcatt
agggcagcattgctttttaaactggctggtgaacaacaaattgcgtttggatcatcaaca
ccagcagcttctactggtaactttgacattgatcttgaaaagcttgtgtctatgacaagg
aaccagaacatgtccaatttgcagcaatatggaggggtcaaaggtgttgcagagaagttg
aagtcaaatatggaacaaggaatcaatgaggatgagaaagaggtgatagataggaagaat
gcttttggatctaacacttacccaaaaaagaaggggaaaaacttttttatgttcctctgg
gaagcttggcaagatttaactctcatcatcttgatcatagcggctgtaacatcattggca
ttgggaataaagacagagggtttgaaagaaggttggcttgatggtggaagcattgccttt
gcggttttgcttgtcattgttgttacagctgttagtgactatcgccaatctctccagttt
caaaacctcaacgatgaaaaaagaaatatacaactagaggtcatgagaggagggagaaca
gtgaagatatcaatctatgacgttgttgtcggagatgttatacctcttaggataggtgac
caggtccctgcggatggagtgctaattagtggtcattctcttgctattgatgaatctagc
atgaccggtgaaagcaagattgttcacaaggatcaaaaatccccttttctaatgtctggc
tgtaaagtagctgacggagtcggtaacatgctggttactggtgttggaatcaacactgag
tggggattgttgatggcaagtatctcagaagatactggtgaagaaactccattgcaggtg
aggttaaatggtcttgcaaccttcatagggatagtggggctctcagtggctcttgttgtc
ctggtggctcttcttgtgagatattttaccggaactactcaagatactaatggagcgacc
cagtttatcaaagggacgactagtatcagtgacattgtagatgattgtgtaaagatattt
acaatcgccgtgacaattgtggttgtagcagtgcctgagggacttcccctagcagttacc
ctcactttggcttactcaatgcgaaagatgatggcagacaaagctttggttagaaggctt
tcagcttgtgaaaccatgggatcagcaacaacaatctgcagtgacaaaactggaacttta
actttgaatcagatgactgtggttgaaacttatgctggaggatcaaagatggatgtagca
gacaacccttccggtctccaccctaaacttgttgccttaataagtgagggtgttgcacaa
aacacaacaggaaacatttttcatcccaaggatggtggagaggtggagatttctggatct
cccacagagaaggctattctgtcttgggcttataagttggggatgaagtttgataccatc
aggtcggagtctgctatcatccatgccttccctttcaattcagagaaaaagcgtggtggt
gttgctgtgcttcgaggtgattctgaagttttcattcactggaagggagcagcagagata
gttttggcttgctgtacacaatacatggactcaaatggtactctgcagtccattgagagc
caaaaggaatttttcagagttgctatcgatagcatggcgaaaaatagcttgcgatgtgtt
gctattgcatgcagaacacaagagctgaaccaagttcccaaggaacaagaggacttggat
aaatgggctttacctgaagatgaactcattttgcttgctatcgttggcataaaggatcct
tgtcgtcccggtgtcagagaagcagtgagaatctgtaccagtgctggtgttaaggtacga
atggtgactggtgacaatcttcaaacagcaaaagcaattgctttggagtgtggtatactt
tcttcagatacagaagctgttgagcctactatcatcgaaggaaaagtgttccgtgagcta
tctgagaaagagagagaacaagtagccaagaaaataacggtgatgggtaggtcatctcct
aacgacaagctcttacttgttcaagcactacggaaaaatggagatgttgttgcagtcact
ggtgatggtactaatgatgctcctgccctccatgaggcagatataggtctctctatgggt
atatcaggaactgaagttgcaaaagagagttctgacatcattattttggatgacaatttt
gcttcagtagtaaaggttgttcgttggggccgttctgtgtatgctaacattcagaaattc
atacaattccagcttactgtgaatgttgccgcacttataatcaatgttgtagcagcaatg
tcttctggtgacgtccctctaaaggctgtacagctgctttgggtcaaccttatcatggat
actcttggagcacttgcactagctacagagccaccaaccgatcatcttatgcatagaacc
cctgttggaagaagggaacctcttataacaaacatcatgtggaggaacttgcttgttcag
tcattctatcaagtggctgttctcctagttctcaactttgcaggcttaagcattcttggc
ttgaaccatgaaaaccatgcacatgctgtggaagtgaagaacactatgatattcaatgcc
tttgtcatgtgtcaaatattcaacgagttcaacgcaagaaaacctgatgaaatgaatgta
ttccggggagtaaataagaaccctctcttcgtagcaattgttggagtcacttttatactt
cagatcatcatcgttactttcctcggaaagtttgctcacaccgttagactgggatggcag
ttatggcttgcttctataatcattggattggtcagctggccactagcaattgttgggaaa
ctgatccctgtacccaagacaccgatgagcgtctacttcaagaaaccgttccgtaaatac
aaagcttcaagaaatgcataa

DBGET integrated database retrieval system