KEGG   Arabidopsis thaliana (thale cress): AT3G21220Help
Entry
AT3G21220         CDS       T00041                                 

Gene name
MKK5
Definition
(RefSeq) MAP kinase kinase 5
  KO
K13413  mitogen-activated protein kinase kinase 4/5 [EC:2.7.12.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04016  MAPK signaling pathway - plant
ath04075  Plant hormone signal transduction
ath04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    AT3G21220 (MKK5)
   04075 Plant hormone signal transduction
    AT3G21220 (MKK5)
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    AT3G21220 (MKK5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT3G21220 (MKK5)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     AT3G21220 (MKK5)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: STE group
  STE7 family
   AT3G21220 (MKK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Haspin_kinase Pkinase_fungal RIO1 Kdo
Motif
Other DBs
NCBI-GeneID: 821676
NCBI-ProteinID: NP_001319606
MIPS: AT3G21220.1
TAIR: AT3G21220
Araport: AT3G21220
UniProt: Q8RXG3 A0A178VIK5
Position
3
AA seq 348 aa AA seqDB search
MKPIQSPSGVASPMKNRLRKRPDLSLPLPHRDVALAVPLPLPPPSSSSSAPASSSAISTN
ISAAKSLSELERVNRIGSGAGGTVYKVIHTPTSRPFALKVIYGNHEDTVRRQICREIEIL
RSVDHPNVVKCHDMFDHNGEIQVLLEFMDQGSLEGAHIWQEQELADLSRQILSGLAYLHR
RHIVHRDIKPSNLLINSAKNVKIADFGVSRILAQTMDPCNSSVGTIAYMSPERINTDLNH
GRYDGYAGDVWSLGVSILEFYLGRFPFAVSRQGDWASLMCAICMSQPPEAPATASQEFRH
FVSCCLQSDPPKRWSAQQLLQHPFILKATGGPNLRQMLPPPRPLPSAS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgattcaatctccttctggagtagcttcacctatgaagaaccgtttacgcaaa
cgtcctgacctaagcttaccactcccacaccgcgacgtcgctctcgccgtacctctccct
ctcccacctccttcttcctcttcatccgctccggcgtcttcctccgcgatctcaaccaac
atctccgccgctaaaagcttatccgagctagaacgagtgaaccgaatcggaagcggagcc
ggaggaacggtttacaaagtaatccacactccgacgtcacgtcctttcgctctcaaagtg
atttacggaaaccacgaagataccgtgagacgtcagatctgtagagagatcgagatctta
agaagtgttgatcatccaaacgttgtgaaatgtcacgatatgtttgatcataacggtgag
atccaggttttgcttgagtttatggatcaaggatctcttgaaggagctcatatatggcaa
gaacaggaattagctgatctctctcgtcagattcttagtggattagcttatcttcatcgt
cgtcatatcgttcatcgtgatatcaaaccttcgaatcttcttataaactcagctaaaaat
gtgaaaattgctgattttggtgtgagtaggatcttggcacaaacaatggatccttgtaat
tcatctgttggtactattgcttatatgagtcctgagaggattaatactgatttgaatcat
ggtcgttacgatggttatgctggagatgtttggagtttaggtgttagtatcttggagttt
tacttggggaggtttccttttgctgtgagtagacaaggtgattgggctagtcttatgtgt
gctatttgtatgtctcagccacctgaagctccggctacggcgtctcaggagtttcgtcac
tttgtttcttgttgtttacagagtgatcctcctaagagatggtcagctcaacagcttttg
cagcatcctttcatacttaaagctaccggtggtcctaatctccgtcaaatgttgccgccg
cctcgtcctcttccttctgcctcttag

DBGET integrated database retrieval system