KEGG   Arabidopsis thaliana (thale cress): AT3G21540Help
Entry
AT3G21540         CDS       T00041                                 

Definition
(RefSeq) transducin family protein / WD-40 repeat family protein
  KO
K14556  U3 small nucleolar RNA-associated protein 12
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    AT3G21540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ath03009]
    AT3G21540
Ribosome biogenesis [BR:ath03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    AT3G21540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Utp12 WD40_like Nup160 eIF2A Rhamnogal_lyase
Motif
Other DBs
NCBI-GeneID: 821708
NCBI-ProteinID: NP_188791
MIPS: AT3G21540.1
TAIR: AT3G21540
Araport: AT3G21540
UniProt: Q9LVF2
Position
3
AA seq 955 aa AA seqDB search
MVKAYQRYDAATSFGVISSVDSNIAYDSTGKYVLAPALEKVGIWHVRQGVCSKTLTPSSS
RGGPSLAVTSIASSASSLVAVGYADGSIRIWDTEKGTCEVNFNSHKGAVTALRYNKVGSM
LASGSKDNDIILWDVVGESGLFRLRGHRDQVTDLVFLDGGKKLVSSSKDKFLRVWDLETQ
HCMQIVSGHHSEVWSVDTDPEERYVVTGSADQELRFYAVKEYSSNGSLVSDSNANEIKAS
EEHSTENKWEILKLFGEIQRQTKDRVARVRFNVSGKLLACQMAGKTIEIFRVLDEAEAKQ
KAKRRLRRKEKKSSKVGDENSTANGEASAKIELADAVSSPTVLDVFKLLQVIRAGRKISS
FSFCPTAPKESLGTLALSLNNNSLEFYSLKSSENAKTVTIEHQGHRSDVRSVTLSEDNTL
LMSTSHSEVKIWNPSTGSCLRTIDSGYGLCSLIVPQNKYGIVGTKSGVLEIIDIGSATKV
EEVKAHGGTIWSITPIPNDSGFVTVSADHEVKFWEYQVKQKSGKATKKLTVSNVKSMKMN
DDVLAVAISPDAKHIAVALLDSTVKVFYMDSLKFYLSLYGHKLPVMCIDISSDGELIVTG
SQDKNLKIWGLDFGDCHKSIFAHGDSVMGVKFVRNTHYLFSIGKDRLVKYWDADKFEHLL
TLEGHHAEIWCLAISNRGDFLVTGSHDRSMRRWDRSEEPFFLEEEKEKRLEELFESEIDN
AADDRHGPMEEIPEEGVAALAGKKTIDVLSAADSIIDALEVAEDETKRHAAYEEEKTKGK
VPEYLPNAVMFGLSPSEYVLRAISNVRTNDLEQTLLALPFSDSLKFLCYMKDWSLIPEKV
ELVSRIATIILQTHHNQLVTTPSARPILSVLRDILYSEIKACKDTIGFNLAAMDHVKQMM
DARSDAPFKDAKAKLLEIRSQQAKRMASRGDTKMEKKRKKKQKKLEEGQHGHALF
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggcttaccaaagatacgatgcagcgacctctttcggtgtgatttcatctgta
gattcgaacatagcttacgattcgacggggaagtatgtgcttgctccggcgttggagaag
gtcggaatatggcacgtccggcaaggtgtctgctccaaaaccctaactccttcctcctct
cgcggtggaccatctctcgccgttacctctatagcctcctctgcttctagcttggtggca
gttgggtatgcagatgggagcataagaatatgggatactgagaaaggaacttgtgaggtt
aattttaatagccataagggggcggtgactgctttgcggtacaataaggttggatcgatg
cttgcatctggaagtaaagataatgatattatcttgtgggatgttgttggcgaatcaggt
ctttttcgtctccgtgggcaccgagatcaggtcacagatcttgtattcttggatggtggt
aagaaacttgtaagttcatctaaggacaagttcttgagagtctgggatcttgagacccaa
cactgtatgcaaatagttagtggtcatcatagtgaagtgtggtctgttgatactgatcca
gaggagagatatgttgttactgggtcggctgatcaagaacttagattttatgctgtcaag
gaatattcgtctaacggatcattggtatctgactcaaatgcaaatgaaatcaaggccagt
gaagaacattcgacagagaacaagtgggaaattctaaagctgtttggggaaattcagaga
caaactaaggatagagttgcgagagttagattcaatgtttcgggaaaacttctggcttgt
caaatggcaggtaaaactattgaaatattccgggttttggatgaagctgaggctaagcag
aaagcaaagcgtaggcttcgcagaaaagagaagaagagttccaaagtgggggatgaaaat
tcaaccgctaatggcgaagcaagtgctaaaattgaactagctgatgctgtttctagtcct
actgtccttgatgttttcaagctcttacaagtcattagagctgggagaaaaatcagctct
ttctctttctgtccgacagctccaaaagaatccttaggaacattagctctctctttgaac
aataactcactggaattctattcccttaaaagcagcgaaaacgcgaaaactgttaccatt
gaacaccaaggacatcgctctgatgtgaggagtgttaccctcagtgaagacaacaccctt
ttgatgtcaaccagtcacagtgaagtaaaaatttggaatcccagtacaggttcctgcctc
cggaccattgattcaggatatggattatgcagtttgattgttccccaaaacaagtatggt
attgttggaaccaagagtggggtacttgaaatcattgatatagggagcgctaccaaagtg
gaagaagtgaaggctcatggtggcactatttggtcaattacacctattccaaacgatagc
gggtttgtcacagtcagtgcagatcatgaagtcaaattctgggaataccaagtcaaacag
aaatctggcaaggcgaccaagaaactcactgtttcaaatgttaagtccatgaagatgaat
gacgatgtacttgctgttgctatcagcccggatgctaaacacatagcagttgcactgctt
gattccacagtgaaggttttctacatggattccctaaaattctacctctccttatatggc
cacaagttgcctgtgatgtgcattgacatctcatcagatggagagttgattgttactggt
tctcaggacaaaaatttgaaaatttggggtttggattttggtgattgtcataagtctatc
tttgctcatggtgacagtgtcatgggtgtaaaatttgttcggaatacccattatctgttc
agcattgggaaagaccgcctcgtcaagtattgggatgctgacaaattcgagcatttgtta
acgcttgaaggacatcatgcagagatttggtgccttgctatcagtaaccgtggtgatttt
ctcgtaacaggatctcatgaccgctccatgcgtcgctgggatcgctctgaagaacctttc
ttcctcgaggaagagaaggaaaagaggttagaagagctttttgagtctgagattgataat
gcagcagatgacaggcatggacccatggaggaaattccagaggaaggtgttgcagcatta
gctggcaagaagacgatagatgttctatcagctgctgattcaattatagatgctctggaa
gtagcagaagatgaaacaaagcgtcatgctgcttatgaggaggagaaaacaaagggaaaa
gttcctgaatacctacccaacgctgtgatgttcgggctttctccgtccgaatatgttctc
agggccatctcaaatgtgagaacaaatgatcttgagcagactttgctggctctaccattc
tcagattctttgaagtttctttgctacatgaaagactggagtttaattcccgaaaaggta
gagttggttagcagaatcgcaaccattatattacagacacatcacaaccagttggtaaca
acaccatctgccagaccaatcttaagcgttctcagggacattctttactcagaaatcaag
gcatgcaaagatacaatcggtttcaatttggccgccatggatcatgtcaagcaaatgatg
gatgcaagatctgatgctcccttcaaagatgcaaaggccaagctattggagataaggtca
cagcaagcaaaacgtatggcatcacgaggagatacaaagatggagaaaaagagaaagaag
aagcagaagaaattagaggaaggacaacatggccatgctttgttctga

DBGET integrated database retrieval system