KEGG   Arabidopsis thaliana (thale cress): AT3G22960
Entry
AT3G22960         CDS       T00041                                 
Symbol
PKP-ALPHA
Name
(RefSeq) Pyruvate kinase family protein
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00620  Pyruvate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ath_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT3G22960 (PKP-ALPHA)
   00620 Pyruvate metabolism
    AT3G22960 (PKP-ALPHA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G22960 (PKP-ALPHA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT3G22960 (PKP-ALPHA)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     AT3G22960 (PKP-ALPHA)
Membrane trafficking [BR:ath04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AT3G22960 (PKP-ALPHA)
Exosome [BR:ath04147]
 Exosomal proteins
  Proteins found in most exosomes
   AT3G22960 (PKP-ALPHA)
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI DacZ_T
Other DBs
NCBI-GeneID: 821870
NCBI-ProteinID: NP_566720
TAIR: AT3G22960
UniProt: Q9LIK0
Position
3:8139185..8142052
AA seq 596 aa
MSQSIQFSTPSHTPHLLHLPHSQFNRPLSSISFRRFPLTTIKYTSIRASSSSSPSPDLDS
SSSSSSSQVLLSPNGTGAVKSDERSVVATAVTTDTSGIEVDTVTEAELKENGFRSTRRTK
LICTIGPATCGFEQLEALAVGGMNVARLNMCHGTRDWHRGVIRSVRRLNEEKGFAVAIMM
DTEGSEIHMGDLGGEASAKAEDGEVWTFTVRAFDSSRPERTISVSYDGFAEDVRVGDELL
VDGGMVRFEVIEKIGPDVKCLCTDPGLLLPRANLTFWRDGSLVRERNAMLPTISSKDWLD
IDFGIAEGVDFIAVSFVKSAEVINHLKSYLAARSRGGEIGVIAKIESIDSLTNLEEIILA
SDGAMVARGDLGAQIPLEQVPAAQQRIVQVCRALNKPVIVASQLLESMIEYPTPTRAEVA
DVSEAVRQRSDALMLSGESAMGQFPDKALTVLRTVSLRIERWWREEKRHESVPLQAIGSS
FSDKISEEICNSAAKMANNLGVDAVFVYTTSGHMASLVSRCRPDCPIFAFTTTTSVRRRL
NLQWGLIPFRLSFSDDMESNLNKTFSLLKSRGMIKSGDLVIAVSDMLQSIQVMNVP
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgtctcagtctattcaattctccactccttcacacactcctcaccttctccatctccct
cactcacaattcaaccgtcctctctcctctatctccttccgtcgcttccctctaacaacc
atcaaatacacttccatcagagcctcctcgtcatcatctccttcaccggatctcgattca
tcgtcctcatcatcatcctcgcaagtacttctctcacctaacggtactggtgctgtgaag
tctgatgagagatccgttgtcgctacggcggttacgactgatacgtctgggattgaggtt
gatactgtgacggaagctgagcttaaggagaatggatttagaagtacgaggaggacgaag
ctgatctgtacgatcggaccggcgacttgtggatttgagcagcttgaggcgcttgctgtg
ggaggtatgaatgtggcaaggcttaatatgtgtcacggtacgcgtgattggcaccgcggt
gtgattcgtagtgttcggaggcttaatgaggagaaaggctttgcggttgctattatgatg
gatactgaaggtagtgagattcatatgggagatcttggtggtgaagcttcagctaaagca
gaggatggtgaggtttggactttcactgttagagcttttgattcttctcgtcctgaacgt
accattagtgttagctacgatggtttcgctgaagatgtaagagttggggatgaacttttg
gttgatggtgggatggtgagatttgaagtgattgagaagattggtcctgatgttaagtgt
ctatgtaccgatcctggattgttgcttcctcgagctaacttgacgttttggagagatgga
agtcttgtacgagagcgtaatgccatgcttccaacaatttcttccaaggactggttggat
attgattttggaattgctgaaggtgtggatttcattgctgtatcgtttgtcaagtcggct
gaagtcattaatcaccttaaaagttatcttgctgctcgttcccgtggaggggaaattgga
gtgattgcaaagatcgagagtatcgattcactgaccaatttggaagaaattattctagca
tcagatggggccatggttgcaagaggagatctgggagctcagatacctcttgagcaagtt
ccagcagctcaacagagaatcgtccaagtatgcagagctcttaacaaacccgtcattgtc
gcttcacagctattggagtccatgattgagtacccaactccaaccagagcagaagttgcc
gacgtgtctgaagcagtaagacaaagatcagatgcattgatgctctctggagaatcagct
atgggacaattcccagacaaggcgctcacggttctaaggactgtcagtttaagaatcgag
agatggtggagggaagagaaacgccatgagtctgtaccgcttcaagccataggctcttca
ttttcagacaaaatctcagaagagatctgtaactcagctgctaaaatggctaacaatctt
ggagtggacgcggttttcgtttacacaacgagcggacacatggcatcactggtctcccga
tgtcgcccggactgcccgatctttgctttcacaaccacaacctcagtgagaagacgctta
aacctacaatggggacttatcccattccgtctcagcttctcagacgacatggaaagcaac
ttgaacaaaacattctcgttactgaaatcaagaggtatgatcaaatctggtgacctcgtg
atcgcagtctcggacatgctgcaatcaatccaggtaatgaacgtcccgtaa

DBGET integrated database retrieval system