KEGG   Arabidopsis thaliana (thale cress): AT3G23000Help
Entry
AT3G23000         CDS       T00041                                 

Gene name
CIPK7
Definition
(RefSeq) CBL-interacting protein kinase 7
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr NAF Kinase-like Kdo APH ABC1 Seadorna_VP7 RIO1
Motif
Other DBs
NCBI-GeneID: 821874
NCBI-ProteinID: NP_188940
MIPS: AT3G23000.1
TAIR: AT3G23000
Araport: AT3G23000
UniProt: Q9XIW0 A0A178VLC2
Position
3
AA seq 429 aa AA seqDB search
MESLPQPQNQSSPATTPAKILLGKYELGRRLGSGSFAKVHLARSIESDELVAVKIIEKKK
TIESGMEPRIIREIDAMRRLRHHPNILKIHEVMATKSKIYLVMELASGGELFSKVLRRGR
LPESTARRYFQQLASALRFSHQDGVAHRDVKPQNLLLDEQGNLKVSDFGLSALPEHLQNG
LLHTACGTPAYTAPEVISRRGYDGAKADAWSCGVILFVLLVGDVPFDDSNIAAMYRKIHR
RDYRFPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTNWFKKSLETSEFHRNVFDSEVEM
KSSVNSITAFDLISLSSGLDLSGLFEAKKKKERRFTAKVSGVEVEEKAKMIGEKLGYVVK
KKMMKKEGEVKVVGLGRGRTVIVVEAVELTVDVVVVEVKVVEGEEDDSRWSDLITELEDI
VLSWHNDIM
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaatcacttccccagccgcaaaaccaatcatctccggcaacaactccggcgaagatc
ctccttgggaaatacgaactcggtcgtcgtctcggtagcggaagcttcgcgaaagtccat
ttagctcgatcaatcgaatccgacgagctcgtcgccgttaaaatcatcgagaagaagaaa
acaatcgaatccggtatggaaccaagaataatcagagagatcgatgcgatgcgtcgtctt
cgtcatcatccaaacatactcaagatccatgaagttatggcaaccaaatctaagatctat
ctcgtaatggaactcgcttccggtggtgaacttttctcaaaagtcctccgtcgtggacgt
cttcctgaatcaacggcgcgtcgttactttcaacaactcgcctccgctcttcgtttctct
caccaagacggtgtcgctcaccgtgatgtgaaacctcagaatctactcttagatgagcaa
ggtaacctcaaggtctctgactttggtttatcagctttaccggagcatctacaaaacgga
ttgcttcacacggcgtgtggtactccggcttatacagctccggaggttatttcacggagg
ggatacgacggagcaaaagctgatgcgtggtcttgtggtgtgattttgtttgttttattg
gttggcgatgttccatttgatgattcgaatatcgctgcgatgtatcggaagattcatcgg
agagattatcggtttccgagctggatttcgaaacaagctaaatcgataatctatcagatg
ttagatccgaatccagtaacgaggatgagtattgaaacagtgatgaaaacgaattggttc
aagaagtctctagagacttctgagtttcatcgtaacgtctttgattcggaagtagagatg
aaatcgagtgttaattcgattactgcttttgatttgatctcgttatcgtcgggattagat
ctttctggattgtttgaggctaagaagaagaaggagaggagattcacggcgaaggtttcg
ggtgttgaagtggaggagaaggcgaagatgattggggagaagttaggttatgtagtgaag
aagaagatgatgaagaaggaaggagaagtgaaggttgttggattagggagaggaagaact
gtgattgtggtggaagcagtggagttaacggtggatgttgtggtggttgaagtgaaagtt
gttgaaggtgaagaagatgattcacggtggtctgatttgattactgagcttgaagatata
gttctttcatggcacaatgacatcatgtaa

DBGET integrated database retrieval system