KEGG   Arabidopsis thaliana (thale cress): AT3G23870
Entry
AT3G23870         CDS       T00041                                 
Name
(RefSeq) magnesium transporter NIPA (DUF803)
  KO
K22733  magnesium transporter
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT3G23870
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC57: NiPA-like magnesium transporter
   AT3G23870
SSDB
Motif
Pfam: Mg_trans_NIPA EamA
Other DBs
NCBI-GeneID: 821970
NCBI-ProteinID: NP_001326607
TAIR: AT3G23870
UniProt: Q9LIR9 A0A178VIA3
Position
3:8619192..8621949
AA seq 335 aa
MDQMSPDNINGVILAVSSSIFIGSSFIIKKKGLKKAGASGVRAGEGGYGYLKEPWWWAGM
ITMIVGEVANFAAYAFAPAILVTPLGALSIIFSAVLAHFILKEKLHMFGILGCILCVVGS
TTIVLHAPHEQKIESVKQIWQLAIEPGFLVYSAVIVIVVAILIFYYEPRYGKTHMIVYVG
ICSLMGSLTVMSVKAVAIAIKLTFSGTNQFKYFNTWIFILVVATCCILQINYLNKALDTF
NTAVISPVYYVMFTTFTIIASMIMFKDWASQSGLKIATELCGFVTILSGTFLLHKTKDMG
NSASGRGSISMPTRDTPVFTNSGSGRSSSSDKVAS
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggatcaaatgtcacctgataacataaatggagtcattttagcagtgtcttcaagtatc
tttattggttctagcttcatcatcaagaaaaaaggtctcaagaaagccggtgcaagcggt
gtccgagcaggtgaaggagggtatggatacttgaaggagccatggtggtgggctggaatg
ataacaatgattgttggggaagtagctaattttgcagcctatgcatttgcaccggctatt
ttggtaacacctttgggagctttaagtattatattcagcgcagtgctcgcgcattttatt
ttgaaagagaaattgcatatgtttgggatacttggttgcattctctgtgttgttgggtct
acaactatagtcttacacgcaccacatgaacagaaaatagaatcagtcaagcaaatatgg
cagcttgctattgaaccaggtttccttgtgtattctgctgtgattgtgattgtggtggct
atactgatcttctactatgaaccgcgctacgggaagactcatatgatcgtatatgtcgga
atctgctccttaatgggttctcttactgttatgagtgtcaaagctgtggcgattgcgatt
aaactgacattttcagggacgaatcagtttaaatacttcaacacttggattttcatttta
gtagttgcaacttgttgcattttgcagatcaactacttgaacaaggcattggatacattc
aacacagcggttatttctccggtttactacgttatgttcacaacattcacaatcatagct
agtatgatcatgttcaaggattgggcttctcagagtggattaaagattgcaacagagttg
tgtggttttgtgacgattttatcaggaacttttctgcttcacaagaccaaagatatggga
aacagtgcaagtggtcgtggttctatctcaatgcctactagagacactcctgtcttcact
aattcaggatccggtcggagctccagctctgataaagtagcttcctga

DBGET integrated database retrieval system