KEGG   Arabidopsis thaliana (thale cress): AT3G24010Help
Entry
AT3G24010         CDS       T00041                                 

Gene name
ING1
Definition
(RefSeq) RING/FYVE/PHD zinc finger superfamily protein
  KO
K11346  inhibitor of growth protein 4
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ath03036]
    AT3G24010 (ING1)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    HBO1 complex
     AT3G24010 (ING1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ING PHD PHD_2 zf-HC5HC2H
Motif
Other DBs
NCBI-GeneID: 821986
NCBI-ProteinID: NP_566742
MIPS: AT3G24010.1
TAIR: AT3G24010
Araport: AT3G24010
UniProt: Q9LIQ6 A0A178VK01
Position
3
AA seq 234 aa AA seqDB search
MSFAEEFEANLVSLAHVLQKKYALLRDLDKSLQENQRQNEQRCEKEIEDIRRGRAGNITP
NTSLTKFSEEALDEQKHSVRIADEKVTLAMQAYDLVDMHVQQLDQYMKKSDEVIRKEKEA
AAATLELENNGKAGNAGEGGRGGRKKTRLATAASTAAASTGMTSSNMDLDLPVDPNEPTY
CICNQVSFGEMVACDNNACKIEWFHFGCVGLKEQPKGKWYCPECATVKKSRKGR
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgccgaggaatttgaagctaatcttgtttcgctggcccatgttttgcagaag
aaatatgctctcctgcgcgatttggataaaagtttgcaagaaaaccaacgacaaaatgaa
caacgctgtgaaaaagaaatagaggatataagaaggggcagagctggaaatatcacacct
aatacctctcttacaaagttctcagaggaagcacttgatgaacagaaacacagtgtccgg
attgctgacgagaaagtcacactggctatgcaggcatatgatctggtggatatgcatgtt
cagcaacttgaccagtatatgaaaaaatccgacgaagtgatccgcaaagagaaagaagct
gccgctgcgacattagaactggagaacaacgggaaagccgggaatgctggtgaaggtgga
agaggagggcgaaaaaagacaaggctagcaacagcagcgtcaacagcagcagcatcaact
gggatgacttcaagtaatatggatctggatctgcctgtggatccaaacgaaccaacttac
tgcatctgcaaccaagttagctttggcgagatggttgcgtgtgacaacaatgcgtgcaag
attgagtggttccatttcggttgcgtcggtctgaaagaacaacccaaggggaaatggtac
tgcccggagtgtgctacagtaaagaagagcaggaaaggtcgatga

DBGET integrated database retrieval system