KEGG   Arabidopsis thaliana (thale cress): AT3G24120Help
Entry
AT3G24120         CDS       T00041                                 

Definition
(RefSeq) Homeodomain-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_CC_LHEQLE Myb_DNA-binding
Motif
Other DBs
NCBI-GeneID: 821998
NCBI-ProteinID: NP_566744
MIPS: AT3G24120.1
TAIR: AT3G24120
Araport: AT3G24120
UniProt: Q94A57 A0A178VFD1
Position
3
AA seq 295 aa AA seqDB search
MYSAIRSLPLDGGHVGGDYHGPLDGTNLPGDACLVLTTDPKPRLRWTTELHERFVDAVTQ
LGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRLGRQAGKESTENSKDASCVGESQDTG
SSSTSSMRMAQQEQNEGYQVTEALRAQMEVQRRLHDQLEVQRRLQLRIEAQGKYLQSILE
KACKAFDEQAATFAGLEAAREELSELAIKVSNSSQGTSVPYFDATKMMMMPSLSELAVAI
DNKNNITTNCSVESSLTSITHGSSISAASMKKRQRGDNLGVGYESGWIMPSSTIG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtactcagcgattcgctcgcttccactcgatggtggacacgttggtggtgactaccat
ggacctcttgacggaaccaatcttcccggtgacgcttgtttggttttaacgactgaccct
aaacctcgtctccggtggacaactgagcttcatgagagattcgttgacgccgttactcag
ctcggtggtcctgacaaagcgactcccaaaactattatgagaacaatgggagtgaagggt
ctcactctctaccacctcaaatcacatcttcagaaattccgcctagggaggcaagctggc
aaagaatcaactgagaactctaaagatgcttcttgtgtaggggagagtcaggacacaggt
tcatcttcgacatcatcaatgagaatggcgcagcaggagcagaacgagggttaccaagtc
accgaagctctacgtgctcagatggaagtccaaagaagactacacgatcaattggaggtg
caacggaggctccagctgaggatagaggcacaaggaaaatacctgcaatcgattcttgaa
aaagcttgcaaggcctttgacgagcaagctgctacttttgctggacttgaggctgctagg
gaagagctatcagagctagccatcaaagtctccaatagctctcaaggaacatcagtcccg
tacttcgatgcaacaaagatgatgatgatgccatcgttgtcagagcttgcagtagcaata
gacaacaaaaacaacatcacaaccaactgttcagtagaaagctctctgacttccatcaca
catgggagctctatatctgctgcatcaatgaagaagcgtcaacgtggagacaatttgggc
gtagggtatgaatcaggctggattatgcctagtagcaccattggataa

DBGET integrated database retrieval system