KEGG   Arabidopsis thaliana (thale cress): AT3G24290Help
Entry
AT3G24290         CDS       T00041                                 

Gene name
AMT1;5
Definition
(RefSeq) ammonium transporter 1;5
  KO
K03320  ammonium transporter, Amt family
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT3G24290 (AMT1;5)
Transporters [BR:ath02000]
 Other Transporters
  Pores ion channels [TC:1]
   AT3G24290 (AMT1;5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp
Motif
Other DBs
NCBI-GeneID: 822017
NCBI-ProteinID: NP_189072
MIPS: AT3G24290.1
TAIR: AT3G24290
Araport: AT3G24290
UniProt: Q9LK16
Position
3
AA seq 496 aa AA seqDB search
MSGAITCSAADLSALLGPNATAAADYICGQLGSVNNKFTDAAYAIDNTYLLFSAYLVFAM
QLGFAMLCAGSVRAKNTMNIMLTNVLDAAAGGLFYYLFGYAFAFGESSDGFIGRHNFGLQ
NFPTLTSDYSFFLYQWAFAIAAAGITSGSIAERTKFVAYLIYSSFLTGFVYPVVSHWFWS
PDGWASPFRSEDRLFGTGAIDFAGSGVVHMVGGIAGLWGALIEGPRIGRFPDGGHAIALR
GHSASLVVLGTFLLWFGWYGFNPGSFTKILIPYNSGSNYGQWSGIGRTAVTTTLSGCTAA
LTTLFGKRLLSGHWNVTDVCNGLLGGFAAITAGCSVVDPWAAIVCGFVASLVLIGCNKLA
ELLKYDDPLEAAQLHGGCGAWGLIFVGLFAKEKYINEVYGASPGRHYGLFMGGGGKLLGA
QLVQIIVIVGWVSATMGTLFFILKKLNLLRISEQHEMRGMDLAGHGGFAYIYHDNDDDSI
GVPGSPVPRAPNPPAV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggagctattacttgctctgcggctgatctctcagccctactcggcccaaatgcc
acggcagcggctgactacatttgcggccagttgggttccgttaacaacaagtttaccgat
gcagcctacgctatagacaacacgtacctcctcttctctgcctatcttgtctttgcgatg
cagctcggcttcgctatgctttgtgctggctccgttagagctaagaacacgatgaacatc
atgctcactaatgtccttgatgctgcagccggaggactcttctactacctctttggttat
gcatttgcctttggtgaatcctccgatggattcattggaagacacaactttggtcttcaa
aactttccgactctcacctcggattactccttcttcctctaccaatgggcgtttgcaatc
gcagccgctggaatcaccagcggctccattgccgagaggactaagttcgtggcgtatttg
atatactcttcttttttgaccgggtttgtttacccagttgtctctcactggttctggtct
ccggatggatgggctagtcccttccgttcagaagaccgtttgtttggcactggagccatc
gactttgctgggtcaggtgttgttcacatggttggtggtatcgcaggattatggggtgcc
cttattgaaggccctcggattggtcggtttcctgatgggggtcatgctattgctctgcga
ggccactctgcctcactcgtcgtcttagggaccttccttctctggtttggttggtacggg
ttcaaccctggttccttcaccaagatactcattccctacaattctggttccaactatggc
caatggagtggaataggccgcaccgcggttacaactacactctcgggatgcacagcggct
ctaaccacactcttcggaaaacgtctcctatcaggccactggaacgtaactgacgtttgc
aacgggttactcggagggtttgcggccataacggcaggttgctctgtggttgatccatgg
gcagcgatcgtatgtggcttcgtggcttccctcgtccttatcggatgcaacaagctcgca
gagctcttaaaatatgacgatccacttgaggccgcacaactacacggagggtgtggtgct
tggggtttgatatttgtaggactgtttgcaaaagagaagtatataaatgaggtttacggc
gcgagcccaggaaggcactacgggctatttatgggcggaggagggaagctattgggagca
caactggttcaaataattgtgattgttggatgggttagtgccacaatgggaacactcttc
ttcatcctcaaaaagctcaatttgcttaggatctcggagcagcatgaaatgcgaggaatg
gatttagcaggtcatggtggttttgcttatatctaccatgataatgatgatgattccatt
ggagtgcctggatctccagtacctcgtgcgcctaaccctccagccgtttga

DBGET integrated database retrieval system