KEGG   Arabidopsis thaliana (thale cress): AT3G25530Help
Entry
AT3G25530         CDS       T00041                                 

Gene name
GLYR1
Definition
(RefSeq) glyoxylate reductase 1
  KO
K18121  glyoxylate/succinic semialdehyde reductase [EC:1.1.1.79 1.1.1.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00630  Glyoxylate and dicarboxylate metabolism
ath00650  Butanoate metabolism
ath01100  Metabolic pathways
ath01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT3G25530 (GLYR1)
   00650 Butanoate metabolism
    AT3G25530 (GLYR1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     AT3G25530 (GLYR1)
    1.1.1.-  
     AT3G25530 (GLYR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored ApbA Shikimate_DH 2-Hacid_dh_C 3HCDH_N IlvN Sacchrp_dh_NADP NAD_Gly3P_dh_N AID
Motif
Other DBs
NCBI-GeneID: 822139
NCBI-ProteinID: NP_566768
MIPS: AT3G25530.1
TAIR: AT3G25530
Araport: AT3G25530
UniProt: Q9LSV0 A0A178VK60
Structure
PDB: 

Position
3
AA seq 289 aa AA seqDB search
MEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEVIKKCKYT
IAMLSDPCAALSVVFDKGGVLEQICEGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPV
SGSKKPAEDGQLIILAAGDKALFEESIPAFDVLGKRSFYLGQVGNGAKMKLIVNMIMGSM
MNAFSEGLVLADKSGLSSDTLLDILDLGAMTNPMFKGKGPSMNKSSYPPAFPLKHQQKDM
RLALALGDENAVSMPVAAAANEAFKKARSLGLGDLDFSAVIEAVKFSRE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagggtttctgggtttgggaatcatgggaaaagccatgtcaatgaatctattg
aagaatggattcaaagtcactgtatggaacagaacactctccaagtgtgatgagcttgtg
gagcatggtgcatcagtatgtgagagtccagctgaagtaatcaagaaatgcaaatacact
attgctatgctctctgatccttgtgctgctctttcggttgttttcgataaaggcggtgtt
ttggagcagatatgtgaaggaaaaggttatatcgatatgtcgactgttgatgcagagact
tctttgaagatcaatgaggcaatcaccgggaagggtggtcggttcgtagaaggtccggtt
tcaggtagcaaaaagccagctgaagatggccaactcattatccttgctgctggtgacaag
gcactctttgaggaatcaatcccagcttttgatgtcttggggaagagatcgttttacttg
ggacaagttggaaacggagctaaaatgaagctaatagtgaacatgataatgggaagcatg
atgaatgcattctctgaggggcttgtattggctgacaagagtggacttagctctgacact
cttttggatattctggatctgggagcaatgactaacccgatgttcaaggggaaaggacct
tcaatgaacaagagtagttacccaccagcatttccattgaaacatcagcagaaagacatg
aggctagctcttgctcttggcgatgaaaacgcggtttccatgcctgtagccgcggctgca
aacgaggcttttaagaaggcgagaagcttgggactaggagatctcgacttctctgctgtg
attgaagctgtgaaattctcccgcgaatag

DBGET integrated database retrieval system