KEGG   Arabidopsis thaliana (thale cress): AT3G25790Help
Entry
AT3G25790         CDS       T00041                                 

Definition
(RefSeq) myb-like transcription factor family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding
Motif
Other DBs
NCBI-GeneID: 822170
NCBI-ProteinID: NP_566778
MIPS: AT3G25790.1
TAIR: AT3G25790
Araport: AT3G25790
UniProt: Q9LS00
Position
3
AA seq 357 aa AA seqDB search
MIKNLSNMKNDNQKREKCCEYIEALEEERRKINVFQRELPLCVELVTQAIEAYKREISGT
STDNLYGQSECSEQTTGECGRILDLFIPIKHSSTSIEEEVDDKDDDDEEHQSHETDIDFD
DKNMKSEWLKSVQLWNQSDAVVSNNRQDRSQEKTETLVELIKINDEAAKKNNNIKSPVTT
SDGGSGGGGGRRGQRKNRRCWSQELHRRFLNALKQLGGPHVATPKQIRDIMKVDGLTNDE
VKSHLQKYRLHARRPSQTTPNNRNSQTQHFVVVGGIWVPQTNHSTANAVNAVASGETTGI
YGPMVSSLPSEWPRHSNFGRKISEDRSRCSNNGFFRCSSPAMSCSTRTKTKDAKIIS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaacttaagtaatatgaagaatgacaatcagaaacgtgaaaaatgttgcgag
tacatcgaagctctcgaagaagaacgtcgcaagatcaatgttttccaacgcgagcttcct
ctttgcgtagagctcgtgactcaagcgattgaggcgtataagagggagatatcagggacg
tcgacggataacttatacggacagtcggagtgctcagagcagaccaccggagaatgtggg
cgcatcttggatctgttcataccaatcaaacactcttcgacctccatagaagaagaggtt
gatgacaaagatgatgatgatgaagaacaccagtctcatgaaaccgacatagattttgat
gacaagaacatgaaatctgaatggctcaagtctgttcagctctggaaccaatccgacgca
gttgtttctaataatagacaggatcgctcacaagaaaagacagagacgctggtagagttg
ataaaaataaacgatgaagcagcgaagaaaaacaacaacataaaatcaccggtgactact
agcgatggtggcagtggcggtggcggtggcagaagagggcagagaaagaataggcggtgt
tggtcgcaagagttacacagacgcttcttgaacgctcttaaacaacttggtggccctcat
gtagctacgccgaaacagataagagatataatgaaggttgatgggttaacaaatgatgaa
gtcaaaagtcatttacagaaatataggctgcatgcaagacggccaagccaaacaacaccg
aacaacagaaactctcaaacgcaacatttcgtggtggttggtggaatatgggtcccacag
actaaccattcaacggccaacgcagtcaacgccgtcgcatcgggtgagaccaccgggatt
tatgggcctatggtcagttcgttgccgtccgagtggccgaggcattccaattttggtagg
aagatttcggaagatagatcaagatgctctaacaacggattttttcggtgtagctcacca
gctatgtcttgttctactcgtacaaagacgaaagatgcaaaaataatatcataa

DBGET integrated database retrieval system