KEGG   Arabidopsis thaliana (thale cress): AT3G26900
Entry
AT3G26900         CDS       T00041                                 
Symbol
SKL1
Name
(RefSeq) shikimate kinase like 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: SKI
Other DBs
NCBI-GeneID: 822306
NCBI-ProteinID: NP_001118711
TAIR: AT3G26900
UniProt: Q9LW20 A0A5S9XG43
Position
3:complement(9911873..9914518)
AA seq 280 aa
MEIFSASASLTLTGFVPRLLPLLSPQARTTLCKPLLSSSSTRLISCHSRIAPSRSLADQS
ASTGISVVDSDPIDVVKRKAMDIAPELKGASIFLVGINNSIKTNTGKLLAEALRYYYFDS
DNLITEAAGGNVSAQALKEADEKAFQESETEVLKQLSSMGRLVVCAGDGAVQSLRNLALL
RHGISIWIDVPLDITAKGDDDSFHSEPSPELFDTLKASYEKSRKGYETADVSISLEKIAT
KLEFEDLEAVTSEDIALEILKEIEKLTRVKKMMEEASRPF
NT seq 843 nt   +upstreamnt  +downstreamnt
atggagatcttctctgcgtctgcttctctaactttaactggattcgttcctcgtcttctt
cccttgctctctcctcaagctcgaactactctctgcaagccgttgctgtcttcttcttct
actagactcatttcttgtcacagtcgtatagctccgtctcggtctctcgcagatcaatcc
gcctctactgggatcagtgttgttgattcggatcccattgatgttgtaaagaggaaagct
atggacatagcccctgaactgaaaggagcttccatatttctggttggaattaataactct
attaaaacgaacacggggaagcttttggctgaggcattacgatattactactttgatagt
gataatttgatcacagaggcggctggtggaaatgtgtctgctcaagctttgaaggaagct
gatgagaaggcttttcaagaatcagagactgaagtgctgaagcagctatcatctatgggt
cggcttgtagtttgcgctggagatggtgcggtccaaagcttgagaaatcttgcacttctt
agacacgggatctccatatggatcgatgttcctctggatatcactgctaaaggggatgat
gattcattccactcagaaccttcccctgagttgtttgacacactaaaagcgagttacgag
aaatcaagaaagggttacgaaacagcagatgtatccatttcccttgaaaaaatagctaca
aagctagaatttgaagacttggaagcagtaacttctgaagacattgctttggagattctg
aaagaaatagagaagttgacaagagtgaagaaaatgatggaagaagcttctcgacctttc
tag

DBGET integrated database retrieval system