KEGG   Arabidopsis thaliana (thale cress): AT3G27380Help
Entry
AT3G27380         CDS       T00041                                 

Gene name
SDH2-1
Definition
(RefSeq) succinate dehydrogenase 2-1
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00020  Citrate cycle (TCA cycle)
ath00190  Oxidative phosphorylation
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT3G27380 (SDH2-1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AT3G27380 (SDH2-1)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AT3G27380 (SDH2-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 822359
NCBI-ProteinID: NP_001118718
MIPS: AT3G27380.1
TAIR: AT3G27380
Araport: AT3G27380
UniProt: Q8LBZ7 A0A178VCX3
Position
3
AA seq 279 aa AA seqDB search
MASGLIGRLVGTKPSKLATAARLIPARWTSTGAEAETKASSGGGRGSNLKTFQIYRWNPD
NPGKPELQNYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGL
ACLTKIQDEASETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPASVPAKEILQ
SKKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLE
AIDDEFKLYRCHTILNCARACPKGLNPGKQITHIKQLQR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctggtttgatcggaagattggttggaacgaaaccgtcgaaattagccacggcg
gcgaggttaattccggcgagatggacctctacaggagcggaggcggaaacaaaagcttcc
tctggcggcggaagaggatcgaacttgaagacttttcagatctatcgatggaatccagat
aatccagggaagccagagcttcaaaattaccagatcgatctcaaagattgtggtccaatg
gtattagatgctttgattaagatcaaaaacgaaatggatccatctcttactttccgtaga
tcatgccgtgaagggatctgtggttcatgtgctatgaacattgatggatgtaacggactt
gcttgtttgacaaagattcaagatgaagcatcggagacgacgattacaccgttgcctcat
atgtttgtgattaaggatttggttgttgatatgactaatttttataatcagtataagagt
attgagccgtggttgaagaggaagactccagcgtctgttcctgctaaggagattttgcag
agtaagaaggatagagctaagcttgatgggatgtatgaatgtattctttgtgcttgttgt
agcacatcttgtcctagttactggtggaatcctgagtcttaccttggtccagctgctttg
ctacacgctaataggtggataagcgacagtcgtgatgagtacactaaggaaagacttgag
gctattgacgacgagttcaagctttaccgttgccatacaatcttgaattgtgctcgtgcc
tgtccaaagggtttgaacccaggaaaacagattactcacatcaagcaacttcagcgttga

DBGET integrated database retrieval system