KEGG   Arabidopsis thaliana (thale cress): AT3G27740
Entry
AT3G27740         CDS       T00041                                 
Symbol
CARA
Name
(RefSeq) carbamoyl phosphate synthetase A
  KO
K01956  carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00220  Arginine biosynthesis
ath00240  Pyrimidine metabolism
ath00250  Alanine, aspartate and glutamate metabolism
ath01100  Metabolic pathways
ath01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AT3G27740 (CARA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT3G27740 (CARA)
   00220 Arginine biosynthesis
    AT3G27740 (CARA)
Enzymes [BR:ath01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     AT3G27740 (CARA)
SSDB
Motif
Pfam: GATase CPSase_sm_chain Peptidase_C26
Other DBs
NCBI-GeneID: 822396
NCBI-ProteinID: NP_566824
TAIR: AT3G27740
UniProt: Q9LVW7 A0A178VAM7
Position
3:complement(10281230..10283935)
AA seq 430 aa
MAMATRTLGFVLPTSLSSQPSFDRRGGGFRVSVIRCSTSPLTFPTSGVVEKPWTSYNARL
VLEDGSIWPAKSFGAPGTRIAELVFNTSLTGYQEILTDPSYAGQFVLMTNPQIGNTGVNP
DDEESGQCFLTGLVIRNLSISTSNWRCTKTLADYLTERDIMGVYDLDTRAITRRLREDGS
LIGVLSTEQSKTDDELLQMSRSWDIVGIDLISDVSCKSPYEWVDKTNAEWDFNTNSRDGK
SYKVIAYDFGIKQNILRRLSSYGCQITVVPSTFPAAEALKMNPDGILFSNGPGDPSAVPY
AVETVKELLGKVPVYGICMGHQLLGQALGGKTFKMKFGHHGGNHPVRNNRTGQVEISAQN
HNYAVDPASLPGGVEVTHVNLNDGSCAGLSFPEMNVMSLQYHPEASPGPHDSDNAFREFI
ELMKRSKQSS
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggccatggcaacaaggactctaggctttgttttgcctacgagcttatcttcccagcct
tccttcgaccgtcgcggcggtggatttagggtttctgtcatccgttgctccacttctcca
ctcacttttcccacttctggtgttgtggagaaaccttggacttcgtacaatgctaggctt
gtgttagaagatggttctatctggcctgctaagtcttttggtgctcctggaacccgtatt
gctgaattggtgtttaacacttccttgacagggtatcaagaaattttaactgatcctagt
tatgctgggcagtttgtgctaatgacaaacccacaaattggtaatactggtgtcaatcct
gatgatgaagaatctgggcaatgctttcttactggtttggtgataagaaacctaagcatt
agtacctcaaactggagatgcacgaagacacttgctgattatctaaccgaaagggacatc
atgggagtttatgatcttgacactcgagcaataacccgtcggttaagagaagatggtagt
cttatcggggtgttgagcacagaacagtccaaaacagatgatgaacttctgcaaatgtct
cgttcatgggatatcgtaggtattgatctaataagtgatgtttcatgtaaatctccctat
gaatgggttgacaaaacaaacgctgaatgggatttcaacacgaattcacgagatgggaaa
tcctacaaagttattgcttacgattttggaatcaagcaaaacatcctaagacgcctttca
tcttacggatgtcaaatcactgttgttccgtccacatttccagctgccgaggcgctgaaa
atgaatccagatgggattttgttcagcaacggtcctggagacccttctgctgtgccatat
gctgttgagacagttaaagagcttctcggtaaagtccctgtttacggaatctgtatgggc
catcagttgcttggtcaagctttggggggtaaaaccttcaagatgaagtttggtcatcat
ggaggaaaccacccagttcgtaacaacagaactggtcaggtggagatcagtgctcagaat
cacaactatgcggttgatccagcttcacttcccggaggcgtagaagtaacacatgtcaat
ctcaatgatggaagctgtgcgggtctatctttcccggaaatgaatgttatgtcactccag
taccaccctgaagcctcccctggacctcacgactctgataacgcatttagagagttcata
gagcttatgaagagatcgaaacaaagctcctga

DBGET integrated database retrieval system