KEGG   Arabidopsis thaliana (thale cress): AT3G28415Help
Entry
AT3G28415         CDS       T00041                                 

Gene name
ABCB22
Definition
(RefSeq) ABC transporter family protein
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:3.6.3.44]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AT3G28415 (ABCB22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT3G28415 (ABCB22)
   04147 Exosome [BR:ath04147]
    AT3G28415 (ABCB22)
   04090 CD Molecules [BR:ath04090]
    AT3G28415 (ABCB22)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.44  xenobiotic-transporting ATPase
     AT3G28415 (ABCB22)
Transporters [BR:ath02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    AT3G28415 (ABCB22)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT3G28415 (ABCB22)
CD molecules [BR:ath04090]
 Proteins
  AT3G28415 (ABCB22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_29 AAA_15 AAA_16 AAA_30 Zeta_toxin AAA_22 RsgA_GTPase AAA_21 AAA_23 DUF87 AAA DEAD ABC_ATPase G-alpha AAA_28 DLIC
Motif
Other DBs
NCBI-GeneID: 822471
NCBI-ProteinID: NP_001327523
MIPS: AT3G28415.1
TAIR: AT3G28415
Araport: AT3G28415
UniProt: Q9LSJ2
Position
3
AA seq 1229 aa AA seqDB search
MKSFGSVRSIFMHANSVDLVLMGLGLIGAVGDGFITPIIFFITGLLLNDIGDSSFGDKTF
MHAIMKNAVALLYVAGASLVICFVEGYCWTRTGERQASRMREKYLRAVLRQDVGYFDLHV
TSTSDVITSVSSDTLVIQDVLSEKLPNFLMSASAFVASYIVGFIMLWRLTIVGFPFFILL
LIPGLMCGRALINISRKIREEYNEAGSIAEQAISLVRTVYAFGSERKMISKFSAALEGSV
KLGLRQGIAKGIAIGSNGVTYAIWGFMTWYGSRMVMYHGAKGGTIFAVIICITYGGTSLG
RGLSNLKYFSEAVVAGERIIEVIKRVPDIDSDNPRGQVLENIKGEVQFKHVKFMYSSRPE
TPIFDDLCLRIPSGKSVALVGGSGSGKSTVISLLQRFYDPIVGEILIDGVSIKKLQVKWL
RSQMGLVSQEPALFATSIEENILFGKEDASFDEVVEAAKSSNAHDFISQFPLGYKTQVGE
RGVQMSGGQKQRISIARAIIKSPTLLLLDEATSALDSESERVVQEALDNATIGRTTIVIA
HRLSTIRNVDVICVFKNGQIVETGSHEELMENVDGQYTSLVRLQIMENEESNDNVSVSMR
EGQFSNFNKDVKYSSRLSIQSRSSLFATSSIDTNLAGSIPKDKKPSFKRLMAMNKPEWKH
ALYGCLSAVLYGALHPIYAYASGSMVSVYFLTSHDEMKEKTRIYVLLFVGLAVLCFLISI
IQQYSFAYMGEYLTKRIRENILSKLLTFEVSWFDEDENSSGSICSRLAKDANVVRSLVGE
RVSLLVQTISAVSVACTLGLAISWKLSIVMIAIQPVVVGCFYTQRIVLKSISKKAIKAQD
ESSKLAAEAVSNIRTITAFSSQERILKLLKMVQEGPQRENIRQSWLAGIVLATSRSLMTC
TSALNYWYGARLIIDGKITSKAFFELFILFVSTGRVIADAGAMTMDLAKGSDAVGSVFAV
LDRYTNIEPEKPDGFVPQNIKGQIKFVNVDFAYPTRPDVIIFKNFSIDIDEGKSTAIVGP
SGSGKSTIIGLIERFYDPLKGIVKIDGRDIRSYHLRSLRQHIGLVSQEPILFAGTIRENI
MYGGASDKIDESEIIEAAKAANAHDFIVTLSDGYDTYCGDRGVQLSGGQKQRIAIARAVL
KNPSVLLLDEATSALDNQSERMVQDALGRLMVGRTSVVIAHRLSTIQNCDTITVLDKGKV
VECGTHSSLLAKGPTGVYFSLVSLQRTRY
NT seq 3690 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttttggaagcgtaagatcaatattcatgcatgcgaacagtgtggatttagtg
ctgatgggattaggtttaatcggagccgtcggtgatggcttcatcactcctataatattt
ttcatcaccgggctgctactcaacgacatcggtgattcctcattcggtgataaaaccttc
atgcatgccatcatgaagaatgccgtagctttgctttatgtcgctggtgcatctttggtg
atatgtttcgttgaaggatattgctggactaggacaggggagagacaagcatcaagaatg
agagagaagtacttaagagcagtgttaagacaagatgtgggttactttgatcttcatgtt
acaagcacttctgatgttatcaccagtgtctctagtgacaccctcgtgatccaagacgtc
cttagtgaaaagttaccaaattttttgatgagtgcatcggcgtttgtcgcaagctacatc
gtgggtttcatcatgctgtggagactaacaatagtaggtttcccgttctttatcctcctc
ttgatccctggactgatgtgcggacgagccctcatcaacatctcgagaaaaatacgtgaa
gagtataatgaggctggttctattgccgagcaagccatctcgttggtgcgaaccgtctac
gcatttggtagtgagaggaagatgatatcgaaattctcagctgcgcttgaaggctcagtg
aagctagggttgagacaaggaatagctaaaggaatcgccattgggagcaatggtgtcact
tacgccatttgggggttcatgacttggtacggaagtcggatggttatgtaccatggagct
aaaggcggtactatcttcgcagtcatcatatgcatcacctatggtggcacatcacttggt
cgaggtttgtcgaatctcaaatatttctccgaggcggttgtagcaggggaaaggattatt
gaagtgataaaaagagttcccgatattgattcggacaacccgagaggtcaagttcttgag
aatattaaaggagaagtccagtttaagcatgtgaagttcatgtactcatcaagacccgag
acaccaatctttgatgatttatgtctaagaatcccatctggtaaatctgttgctctggtg
ggtggaagcggatcaggaaaatcaactgtgatatcgcttttacaaagattttatgacccc
atcgtaggagagattcttatcgatggtgtgtctattaaaaagttgcaagtgaaatggttg
agatcacaaatgggtctagttagccaagagccagcactcttcgccacatcgatagaggag
aacatattatttggtaaagaggacgcatcctttgatgaagtagtggaagctgcaaagtcc
tcaaatgctcatgatttcatttctcagttccctcttggttacaaaactcaggttggggag
agaggagtgcaaatgtcagggggtcagaagcaaaggatttcaattgcacgtgcgataatc
aaatcaccgacacttctactgctagacgaggcaacaagcgcattagattcagaatccgaa
agagtagtccaagaagccttagacaatgccactattggtcgtacaactattgttattgct
caccgcctctctactattcgtaatgttgatgttatatgtgtattcaaaaatggtcagatt
gtagaaactggatcacacgaagagctcatggagaatgtagatggtcaatacacttctcta
gtccgcttacaaatcatggaaaatgaagaatcaaatgataacgttagcgtaagtatgcga
gagggtcaattctcaaatttcaacaaagacgtgaagtatagttcaagactttctattcaa
agtcggtcttcccttttcgcaacttcaagcattgatacaaatcttgctggttcaattcca
aaggataagaagccatcttttaagagattgatggcgatgaataaaccagagtggaaacat
gcattgtatggttgcttaagtgcagtcttgtatggagccttacacccaatttatgcatat
gcttcaggatcaatggtgtcagtgtattttctaacgagtcatgatgagatgaaggagaaa
acaaggatctatgtgttgcttttcgttggtctagctgttttatgtttcttgatcagtatc
attcaacaatatagttttgcttacatgggtgaatacctaacgaaacgtatacgagaaaat
attctctcaaagctattgacctttgaggtaagctggttcgatgaagacgagaactcgagc
ggatcaatttgctctagactagccaaagacgcaaacgtggtgagatcgcttgttggtgaa
cgagtgtcgttgttggtacaaactatatcagcagtgagtgtagcttgcacacttggtttg
gccatttcttggaaattatccattgtgatgattgcaatacaaccagtggttgttggatgc
ttctacactcaacgcattgtactcaaaagcatatcgaaaaaagccattaaagcacaagat
gagagcagcaaactagcggcagaagctgtatccaacatccgaaccataacagcattttcg
tcacaagaacggatcctaaaattactcaaaatggttcaagaaggaccacaaagagaaaat
atccgtcaatcgtggttagcagggattgtgctagcaacttctagaagtctcatgacatgc
acttcagctttgaattactggtacggtgctagacttattattgatgggaagatcacgtca
aaagcattctttgagttgtttatactctttgtgagtacgggtcgggttattgcggacgcg
ggagcaatgacgatggatctagccaagggctcggatgcggtcggatcagtatttgcggtg
ttagatcgttacacaaacattgaaccggagaaaccggatggtttcgtcccacaaaacata
aagggacaaataaagtttgtcaatgtggactttgcgtacccaacacgccctgatgtgatt
atatttaagaacttctccattgatattgacgagggaaagtcgacagcgatagtgggtcca
agcgggtcaggtaaatcaactataatcgggttaatcgaacggttttatgacccgttaaag
ggtattgtaaagatcgatggtcgtgatataaggtcttatcatttgagatcacttcgtcaa
cacataggtttggttagccaagagccaatattatttgctgggacaatccgagagaacatc
atgtatggaggagcatctgacaagattgacgagtcagagattatcgaggcggccaaggca
gccaacgctcatgatttcatcgtaacattatcggacggctatgatacgtactgtggagac
agaggagtacaactatctggtggtcaaaaacagaggatcgcgattgctcgtgcggttttg
aagaacccatcagtgttgcttcttgatgaagctacgagcgctcttgacaaccaatcagag
cgcatggtgcaggatgcactcgggcgtttgatggttggaaggacaagtgttgtgatcgct
cataggcttagcaccattcaaaactgtgacacgataactgttttagacaaagggaaagtt
gtcgaatgtggaacacactcttccttgttagctaaaggtcctacgggtgtatatttctct
ctggtcagtctccaaagaactcgttactga

DBGET integrated database retrieval system