KEGG   Arabidopsis thaliana (thale cress): AT3G30770
Entry
AT3G30770         CDS       T00041                                 
Name
(RefSeq) Eukaryotic aspartyl protease family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: RVP_2 Asp_protease_2 gag-asp_proteas DUF5805
Other DBs
NCBI-GeneID: 822832
NCBI-ProteinID: NP_189700
TAIR: AT3G30770
UniProt: F4J7U9
Position
3:12445493..12448285
AA seq 603 aa
MATQAAQTIPATIVIDLEAKLDQFVQNFEDKLDSIVQRLQAQQKEHRQGMREIFANFFPE
TACDEPPTMKNQEHHELHQSFQRRIILAGKEESILHKLAGEDVFMLIEAIIRTRFHQLFY
EHIQDDASRDKHIGFSSDYEGSQSHELSGGANIRRNSRKLNQVRDNKEGYIRSMKQSVVP
RSQSKGVDLGRVFCFGFQRTNPQMAMKGNSWRSYFYKEEINNNVAPRTEPYGDQATQVEL
MSFIMVEGNTYGYGNEWEGLLEDFKTIRQVKRQSTTEFTKGKDMRFYGFISCHKVVVVID
SGATNNFISDELALVLKLPTSTTNQASVLLGQRQCIQTIGTCFGINLLVQEVEINENFLL
LDLTKTDVDVILGYGGSQNLERQWLIWLNQDFSFFHNQQWVTLCAKDKELEQVTTKVKMK
SEYEQEKIDHYLEDKVVLKGGSKAMWGGIAKDIPWKQKMSGESLAKEILWKQKISGESRK
NFSEIMLKVSRLKSAQTIGNYGGLEAQQGSLGVMPMGYKGVGEKQEEFPLRLIFIGKAGQ
SPRPPELFCGKVLGQEGSLFQKHKGEKGGHLNLWLMTNGGKSWLEAGICLKLQNGVFECC
KIS
NT seq 1812 nt   +upstreamnt  +downstreamnt
atggctactcaagctgctcaaaccattccagccaccatagtcatagatctagaagcaaaa
ctggatcaattcgttcaaaatttcgaagataagctagattccatcgtccaaaggctccaa
gcacaacaaaaggagcatcgacaagggatgcgtgaaatttttgctaactttttcccggag
acagcatgtgacgaaccacctacgatgaagaaccaagagcatcatgagctccatcaaagc
ttccaacgacgtatcattctcgcaggaaaagaagaatccatattacacaagctcgcagga
gaggatgtattcatgttaatcgaagctatcataagaactcgattccatcaattattctac
gagcatattcaagatgatgctagcagagataaacatataggattttcgtctgattatgag
ggatcacagtctcacgaattgagtggtggtgctaatattagaaggaattcacggaaactt
aaccaagtccgagacaacaaggagggttacattcgatcaatgaaacaaagtgtggtgcca
aggtctcagagtaaaggtgttgatttggggagagtattctgttttggttttcagagaaca
aatcctcaaatggctatgaaaggcaacagttggaggagttatttctacaaggaagaaatt
aacaacaatgtcgccccaagaacagaaccatacggtgaccaagcgacacaagtagagcta
atgagctttattatggtggaaggtaatacatatggatatgggaatgagtgggaaggttta
ttagaggattttaagaccataagacaagttaaaaggcaatcaacgacagaatttaccaag
ggcaaggatatgagattctatggcttcatatcatgtcataaggtcgttgtagttatcgat
tctggagcgaccaacaattttatctcagatgagttagctttagttctcaaactacccacg
agcactacaaaccaagcttcagttttattgggacaaaggcagtgcatacaaaccatagga
acttgttttgggatcaatttgttagttcaagaagtagaaatcaatgagaatttcctttta
ttagatctgaccaagactgacgtggatgtgattctagggtatggtggctctcaaaacttg
gagagacaatggttaatttggctgaatcaagatttctccttcttccacaaccaacaatgg
gtcactctttgtgctaaggacaaagaacttgagcaagttactacaaaagtaaagatgaag
agtgaatatgagcaagaaaaaattgatcattaccttgaagacaaggtagttttaaaaggg
gggagtaaggctatgtggggaggaattgctaaggatataccatggaaacagaaaatgagt
ggtgaaagtcttgctaaggaaatactatggaaacagaaaataagcggtgaaagtcgaaag
aatttttcagagattatgttgaaagtgtcaaggctcaagagtgctcaaaccattggaaac
tatggcggattagaggcgcaacagggtagtctaggagtgatgcccatgggttacaagggt
gttggagagaagcaagaggagtttccattgaggcttatatttatcgggaaagcgggtcaa
tcgccacggccaccagaattgttttgtggtaaagtgttgggacaagagggaagtcttttt
caaaaacacaaaggagagaaaggtggtcacctaaacttatggttaatgacgaatggaggg
aagtcttggttagaggctggaatttgtttaaaactgcagaacggagtctttgagtgttgt
aagatatcatag

DBGET integrated database retrieval system