KEGG   Arabidopsis thaliana (thale cress): AT3G43630
Entry
AT3G43630         CDS       T00041                                 

Name
(RefSeq) Vacuolar iron transporter (VIT) family protein
  KO
K22736  vacuolar iron transporter family protein
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT3G43630
Transporters [BR:ath02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   AT3G43630
SSDB
Motif
Pfam: VIT1
Other DBs
NCBI-GeneID: 823461
NCBI-ProteinID: NP_189949
TAIR: AT3G43630
UniProt: Q9M2C3 A0A5S9XHM0
Position
3:15538816..15539418
AA seq 200 aa
MESHNTLNLDMEKDQEKAFDYSKRAQWLRAAVLGANDGLVSTASLMMGVGAVKQNVKIMI
LTGFAGLVAGACSMAIGEFVSVYSQYDIEVAQMKRETGGEIEKEKLPSPTQAAAASALAF
SLGAMVPLLAAAFVKEYKVRIGAIVAAVTLALVMFGWLGAVLGKAPVVKSSLRVLVGGWL
AMAITYGFTKLIGSHSHMYV
NT seq 603 nt   +upstreamnt  +downstreamnt
atggaatctcacaacaccttgaacctagacatggagaaagatcaagaaaaggcttttgac
tactccaaacgagctcaatggctaagagccgctgtgcttggtgccaacgacggtcttgtc
tcgacggcttcacttatgatgggtgttggtgcggtcaagcaaaacgtcaagatcatgatc
ttaactggttttgccggtttagtggccggagcttgtagcatggcgattggagagtttgtc
tctgtttactctcaatatgacatagaggtagctcagatgaagagagagaccggaggagag
attgagaaagagaagcttccaagtccaacacaagcggctgcagcatctgcgttagcgttt
tctcttggggcgatggtgccgttattggcggcagcgtttgtgaaagagtataaagtgagg
attggtgcaatagtggcagcggttacgttggcgttggtgatgtttggatggttaggggcg
gttttggggaaagcaccagtggttaagtcgtcgcttagggttttggttggaggatggtta
gctatggccattacgtatggttttacaaaactcattgggtcacatagtcatatgtatgtg
tga

DBGET integrated database retrieval system