KEGG   Arabidopsis thaliana (thale cress): AT3G44110Help
Entry
AT3G44110         CDS       T00041                                 

Gene name
J3
Definition
(RefSeq) DNAJ homologue 3
  KO
K09503  DnaJ homolog subfamily A member 2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT3G44110 (J3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ath03110]
    AT3G44110 (J3)
   03029 Mitochondrial biogenesis [BR:ath03029]
    AT3G44110 (J3)
Chaperones and folding catalysts [BR:ath03110]
 Heat shock proteins
  HSP40 / DNAJ
   AT3G44110 (J3)
Mitochondrial biogenesis [BR:ath03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    AT3G44110 (J3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP HypA DZR TackOD1
Motif
Other DBs
NCBI-GeneID: 823531
NCBI-ProteinID: NP_189997
MIPS: AT3G44110.1
TAIR: AT3G44110
Araport: AT3G44110
UniProt: Q94AW8 Q0WW92
Position
3
AA seq 420 aa AA seqDB search
MFGRGPSKKSDNTKFYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDPEKFKELAQAYE
VLSDPEKREIYDQYGEDALKEGMGGGGGGHDPFDIFSSFFGGGPFGGNTSRQRRQRRGED
VVHPLKVSLEDVYLGTMKKLSLSRNALCSKCNGKGSKSGASLKCGGCQGSGMKVSIRQLG
PGMIQQMQHACNECKGTGETINDRDRCPQCKGDKVIPEKKVLEVNVEKGMQHSQKITFEG
QADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVLTHLDGRSLL
IKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPDQTKALEAVLPK
PSTAQLSDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDDEDDDHPGGAQRVQCAQQ
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgttcggtagaggaccctcgaagaagagcgacaacactaagttctacgagatcttaggt
gttcctaagagcgcttcaccagaagatctcaagaaagcttacaaaaaagccgctatcaag
aatcatcctgataagggtggagatcccgagaagtttaaggagttagcacaagcttatgaa
gtgcttagtgacccggagaagcgtgagatttatgaccagtatggagaggatgcactcaag
gaaggaatgggtggtggaggaggtggacatgatccatttgatattttctcatccttcttt
ggtggaggcccctttggaggtaataccagccggcaaaggaggcagaggcgtggtgaggat
gttgttcatcccttgaaggtatctcttgaggatgtgtaccttggtacaatgaagaagctt
tcactttctaggaatgctctctgctctaagtgtaacggaaagggatcaaaatctggagcc
tccttgaaatgtggagggtgtcagggatctggtatgaaggtgtctattaggcagcttgga
cctggaatgatccagcagatgcagcatgcatgtaatgaatgcaaagggacaggtgagacc
atcaatgatcgggacaggtgtccacaatgcaaaggagacaaggtcattcctgagaagaag
gtgcttgaagtgaatgtggagaagggaatgcaacacagtcagaagatcacatttgaagga
caagcagatgaagcgcctgacactgtcactggagatatagtgtttgtccttcagcagaaa
gagcacccaaagttcaagagaaagggagaagacctctttgtggagcacacactttctcta
accgaagctttgtgtggcttccaatttgttctgactcacttggatggcagaagtcttctc
attaaatctaatcctggggaggtcgtgaaacctgattcatacaaggcaataagcgatgaa
ggaatgccgatataccagaggccattcatgaagggtaagctctacatccacttcacagtg
gagttcccggactcgttgagcccagatcagaccaaagcactggaagctgttctacctaag
ccgtcaacagctcagttgagtgacatggagatagatgaatgcgaggagaccacgctccac
gatgtcaacattgaggatgagatgaggaggaaggcacaagctcaaagagaggcttatgat
gatgacgatgaagatgatgaccatccgggtggtgctcaaagggtgcaatgtgcccagcag
taa

DBGET integrated database retrieval system