KEGG   Arabidopsis thaliana (thale cress): AT3G44340Help
Entry
AT3G44340         CDS       T00041                                 

Gene name
CEF
Definition
(RefSeq) hypothetical protein
  KO
K14007  protein transport protein SEC24
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT3G44340 (CEF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT3G44340 (CEF)
Membrane trafficking [BR:ath04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    AT3G44340 (CEF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec23_trunk Sec23_BS Sec23_helical zf-Sec23_Sec24 Gelsolin
Motif
Other DBs
NCBI-GeneID: 823559
NCBI-ProteinID: NP_001326943
MIPS: AT3G44340.1
TAIR: AT3G44340
Araport: AT3G44340
UniProt: Q9M291
Position
3
AA seq 1096 aa AA seqDB search
MAAPVPPGAYRPNNNQQNSGGPPNFVPGSQGNPNSLAANMQNLNINRPPPPMPGSGPRPS
PPFGQSPQSFPQQQQQQPRPSPMARPGPPPPAAMARPGGPPQVSQPGGFPPVGRPVAPPS
NQPPFGGRPSTGPLVGGGSSFPQPGGFPASGPPGGVPSGPPSGARPIGFGSPPPMGPGMS
MPPPSGMPGGPLSNGPPPSGMHGGHLSNGPPPSGMPGGPLSNGPPPPMMGPGAFPRGSQF
TSGPMMAPPPPYGQPPNAGPFTGNSPLSSPPAHSIPPPTNFPGVPYGRPPMPGGFPYGAP
PQQLPSAPGTPGSIYGMGPMQNQSMTSVSSPSKIDLNQIPRPGSSSSPIVYETRVENKAN
PPPPTTVDYITRDTGNSSPRYMRCTINQIPCTVDLLSTSGMQLALIVQPMALSHPSEEPI
QVVDFGESGPVRCSRCKGYVNPFMKFIDQGRKFICNLCGYTDETPRDYQCNLGPDGRRRD
ADERPELCRGTVDFVATKEYMVRDPMPAVYFFLIDVSMNAIQTGATAAACSAIQQVLSDL
PEGPRTFVGIATFDSTIHFYNLKRALQQPLMLIVPDVQDVYTPLETDVIVQLSECRQHLE
ILLESIPTMFQESKSPESAFGAAVKAAFLAMKSTGGKLMVFQSVLPSVGIGALSSREADG
RANASAGEKEAHKLLQPADKTLRTMAIEFAEYQVCVDLFITTQAYVDMASISEIPRTTGG
QVYCYYPFSALSDPPKLYNDLRWNITRPQGFEAVMRVRCSQGIQVQEYSGNFCKRIPTDI
DLPAIDCDKAIMVTLKHDDKLQDGAECGFQCALLYTTISGERRIRVLNLSIPCTNMLSNL
FRSADLDSQFACMLKQAANEIPSKALPLVKEQATNDCITILHSYRKFCATVTSTGQLILP
EALKLLPLYTLALTKGVGLRMDGRIDDRSFWINHVSSLSTPLAIPLVYPRMIAVHDLDAN
DNEENVVPCPIPLQSEHLSDEGVYFLENGEDGLIYIGESVNSDILQKLFNVRSAAELPSQ
YVLQKYDNQLSKKFNDVVNEIRRQRSSYLRIKLCKKGDPAGNMLFQSYMVEDRGSGGASY
VDFLVSVHRQIQHKLN
NT seq 3291 nt NT seq  +upstreamnt  +downstreamnt
atggctgctccagtgcctccaggagcatatagacctaataacaatcagcaaaactctggt
ggtcctccgaattttgttcctggttcacaaggaaaccccaattctttagctgctaatatg
cagaatttgaacattaatcggccacctcctcctatgcctggttcaggtcctagaccatct
ccaccttttggtcagtcaccacaatcttttcctcaacaacaacaacaacaaccaaggcct
tctccaatggctagacctggacctcctcctcctgctgctatggctagaccaggtggacct
cctcaggtatcgcaacctggtggttttccgccagttggaagacccgttgctccaccttct
aatcagccaccgtttggtggaagaccatctacaggtccgttggttggtggtggttcgtca
tttcctcagcctggtggttttccagcttcaggtccaccaggaggtgtaccttctggtcct
ccttcaggagcacgtccgattggttttggttctcctccacctatgggacctggtatgtcc
atgcctcctccctctggcatgcctggcggtccgttgagtaatgggcctcctccctctggc
atgcatggcggtcatttgagcaatgggcctcctccctctggcatgcctggcggtccgttg
agtaatggacctcctcctccgatgatgggtccgggggcatttcccagaggatcacaattc
acaagtggtcctatgatggctccaccgccaccatatggacagcctcctaatgcaggccct
tttacgggaaattcaccattatcttcacctcctgctcattcaatacccccgccgacaaat
tttcctggtgtcccttatggcagaccacccatgccaggaggctttccttatggagcacca
ccacaacagctaccttctgctcctggcactcctggttcaatctatggcatgggtccaatg
caaaatcagtcaatgacctctgtttctagcccctcaaagattgatcttaatcagatacca
aggccaggttcaagctccagtccaattgtgtatgaaactcgtgtggaaaataaggctaat
cctccaccacctactactgttgattatataactagagacactggaaattccagcccgcgt
tacatgcgatgcacaatcaatcagatcccatgcactgttgatcttctatctacatctggt
atgcaactggcactaatagtccaaccaatggcgctttctcatccatctgaagagcctatc
caagttgtggactttggtgagagtggccctgttagatgttcacgttgtaagggctacgtg
aatcctttcatgaagttcattgaccaaggaaggaagttcatatgtaacttgtgtggatac
actgatgagactcctcgtgactaccagtgtaatctcggtccagatggtagacgtagggat
gctgatgaaaggcctgagctgtgtaggggaactgttgactttgttgctacaaaagaatat
atggtacgagatccaatgccagcagtatatttcttcctcattgatgtctcaatgaacgcg
attcaaacaggtgcaactgcagctgcttgcagtgcaatccagcaagtcctctcagacctt
cctgaaggtcctaggacatttgttggaattgccacgtttgactcaacaattcacttttat
aatttgaagcgtgcactgcagcagccattgatgctcattgttccggatgttcaagatgtg
tatacacctttagaaacagatgtcattgttcagctatctgagtgccgtcaacacctagag
attttgctggaaagtatcccaacaatgtttcaggaaagtaagagtcctgaatctgctttt
ggtgcagcagttaaggccgcattcttagcgatgaagagcactggaggaaagctcatggtg
ttccaatcagttttgccttctgttggcattggagcactttcttctagagaagccgatggg
agagctaatgcctctgcgggtgaaaaagaggcccataaattactacaacccgcagacaaa
actttaaggaccatggctattgaatttgctgaataccaggtctgtgtagatttgtttatc
acaactcaagcgtatgttgacatggcttcaatttctgagatcccaagaacaactggagga
caggtttattgttattaccctttctcagctctttcagaccccccaaagttatacaacgat
cttagatggaatatcacgaggccccaaggttttgaggctgtcatgcgagtcagatgcagt
cagggtattcaagtgcaagaatactcagggaacttctgtaagcgcataccaactgacatc
gatctacctgcgattgactgtgacaaagctataatggtgacattaaagcatgatgacaaa
ctacaagatggagctgaatgcggttttcagtgtgcccttctgtataccaccatatctgga
gaaaggagaattagggttcttaacttatcaatcccttgtacaaacatgctcagtaacttg
ttccgctcagctgacctagattcccaatttgcttgtatgctgaaacaagcggctaatgag
atcccttcgaaggcacttccgttggtaaaggagcaagcaactaatgattgcatcaccata
ctacattcctatcgtaaattctgcgctacagttacatcaactggacaacttattctacct
gaagcactcaagcttttgccattatatactctcgccttaaccaaaggtgtggggttacga
atggacgggagaattgatgaccgatcattttggataaaccatgtgtcttcattgtccact
cctttggctattccgctagtttatccaaggatgattgctgtccatgaccttgatgcaaat
gataatgaagaaaatgtggttccttgtccaatcccattacaaagtgaacaccttagcgat
gagggagtctattttcttgagaacggtgaagatggtttgatatatattggagaatcagta
aattcagatatcctacagaagctctttaatgttcgctcagctgctgaacttccaagtcag
tatgtgctgcaaaagtatgataatcagctatcaaagaagttcaatgacgtggtgaatgaa
ataaggaggcaaagaagttcttacctacgcattaaattgtgcaagaaaggagatccagct
ggaaatatgttgttccaatcgtatatggtagaggacaggggatcgggtggggcttcgtac
gtggattttctcgtttcagttcaccgtcaaatccaacacaaactgaactga

DBGET integrated database retrieval system