KEGG   Arabidopsis thaliana (thale cress): AT3G44890Help
Entry
AT3G44890         CDS       T00041                                 

Gene name
RPL9
Definition
(RefSeq) ribosomal protein L9
  KO
K02939  large subunit ribosomal protein L9
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AT3G44890 (RPL9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ath03011]
    AT3G44890 (RPL9)
Ribosome [BR:ath03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    AT3G44890 (RPL9)
  Bacteria
    AT3G44890 (RPL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L9_C Ribosomal_L9_N
Motif
Other DBs
NCBI-GeneID: 823623
NCBI-ProteinID: NP_190075
MIPS: AT3G44890.1
TAIR: AT3G44890
Araport: AT3G44890
UniProt: P25864 A0A178VBQ7
Position
3
AA seq 197 aa AA seqDB search
MASSTALSLSWSSSPCWSHSFNGGANETLKVSERRFNFEVVSQKKAKKLRKVILKEDVTD
LGKQGQLLDVKAGFFRNFLLPTGKAQLMTPLLLKELKMEDERIEAEKQRVKEEAQQLAMV
FQTVGAFKVKRKGGKGKLIFGSVTAQDLVDIIKSQLQKDIDKRLVSLPEIRETGEYIAEL
KLHPDVTARVKINVFAN
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcgacagctttgtctctctcatggagctcctctccttgttggtcacacagc
ttcaatggcggtgcaaatgaaaccctaaaagtatctgagcgaaggttcaattttgaagtt
gtttcccagaagaaagctaagaaacttcgcaaggtaattttgaaagaggatgtgacggat
ttgggtaagcaagggcaattacttgatgtgaaagctggatttttcagaaacttcctcttg
cctactggaaaggctcagcttatgactccacttctgctcaaggaattgaagatggaagac
gaacggattgaggcagagaagcaaagggtgaaagaagaggcacaacaactggcgatggta
ttccaaaccgttggtgctttcaaggttaaacgcaaaggcggtaaaggcaaactgatattt
ggatctgtcacagctcaagacctcgtcgacatcatcaaatcacagctccaaaaggacatc
gacaaacgccttgtctctctcccagaaatccgtgaaaccggagaatacatagccgaactc
aagcttcaccccgatgtcactgctcgagttaagatcaatgttttcgctaactaa

DBGET integrated database retrieval system