KEGG   Arabidopsis thaliana (thale cress): AT3G46210Help
Entry
AT3G46210         CDS       T00041                                 

Definition
(RefSeq) Ribosomal protein S5 domain 2-like superfamily protein
  KO
K12590  exosome complex component RRP46
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03018  RNA degradation
Module
ath_M00391  Exosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AT3G46210
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT3G46210
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     AT3G46210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_PH
Motif
Other DBs
NCBI-GeneID: 823766
NCBI-ProteinID: NP_001030817
MIPS: AT3G46210.1
TAIR: AT3G46210
Araport: AT3G46210
UniProt: Q9LX74
Position
3
AA seq 239 aa AA seqDB search
MEIDREDGRTPNQLRPLACSRNILHRPHGSASWSQGDTKVLAAVYGPKAGTKKNENAEKA
CFEVIWKPKSGQIGKVEKEYEMILKRTIQSICVLTVNPNTTTSVIIQVVHDDGSLLPCAI
NAACAALVDAGIPMKHLAVAICCCLAENGYLVLDPNKLEEKKMTAFAYLVFPNTTLSVLP
EGSSVAEGEPVEHGIITSITHGVMSVDDYFLCVENGRAATASLSAFFRKNFQQSSSKAG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggagattgatagagaagatggaagaacaccaaatcagctgagacctcttgcttgttcc
cgtaatatccttcatcgtcctcatggctctgctagttggtcacaaggggatacaaaagtt
ctagctgcggtttatggacctaaagcaggaacgaaaaagaacgaaaatgctgagaaggct
tgttttgaagtcatatggaagcctaaatccgggcagattggaaaagttgaaaaggagtat
gagatgatattgaaaaggacgatacagagtatttgtgttttgactgttaatccaaatacc
accacctcagtgataattcaggttgtgcatgatgatggttctcttctaccatgtgcgata
aatgcagcatgtgcagcgcttgtcgatgcaggaatccctatgaagcatctggctgttgct
atatgctgttgcctggctgagaatggatatctcgtactcgatccaaacaagcttgaagaa
aagaaaatgacggcctttgcttatttagtctttccaaatacaactctctctgttcttccg
gaagggtcatcagtagcggaaggcgagccagtagagcatgggatcatcacatcaattaca
catggagtaatgtcagtggacgattatttcctgtgtgtagagaacggccgtgctgctacg
gctagtttatctgcattttttagaaagaacttccaacaaagttcatccaaggctgggtaa

DBGET integrated database retrieval system