KEGG   Arabidopsis thaliana (thale cress): AT3G46520
Entry
AT3G46520         CDS       T00041                                 

Gene name
ACT12
Definition
(RefSeq) actin-12
  KO
K10355  actin, other eukaryote
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ath04812]
    AT3G46520 (ACT12)
Cytoskeleton proteins [BR:ath04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     AT3G46520 (ACT12)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 823805
NCBI-ProteinID: NP_001327017
MIPS: AT3G46520.1
TAIR: AT3G46520
UniProt: P53497 A0A654FI89
Position
3
AA seq 377 aa
MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREK
MTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
DLAGRDLTDHLMKILTERGYSFTTTAEREIVRDMKEKLSYIALDYEQELETSKTSSSVEK
SFELPDGQVITIGAERFRCPEVLFQPSMIGMENPGIHETTYNSIMKCDVDIRKDLYGNIV
LSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIA
KAEYDESGPSIVHRKCF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggacggtgaagatattcagccgctcgtttgcgataacgggactggaatggtcaag
gctggttttgcaggtgatgatgctcctagagctgtattcccaagtatcgttggccgtcca
cgtcacacgggagtgatggttggaatgggacaaaaggatgcatacgtcggagacgaggca
cagtcgaaacgtggtatcttgactctcaagtatccaattgagcatggtattgtcaacaac
tgggatgatatggagaagatttggcatcacactttctacaatgagctgcgtgttgccccg
gaagagcatccggttttgctaaccgaagcgccgcttaatccgaaggctaaccgtgagaag
atgacacagatcatgtttgaaacattcaacactcctgctatgtatgttgccattcaagct
gttctctccctctatgctagtggccgtactactggtattgttttggactctggagatggt
gtgagccacacggtaccaatctacgagggttatgcacttccacacgcaatcctgcgtctt
gatcttgcaggtcgtgacctaaccgaccacctcatgaaaatcctgacagagcgtggttac
tcattcaccacaactgctgagcgtgagattgtcagagacatgaaggagaagctctcgtac
attgccttggactatgagcaagagcttgagacttccaaaaccagctcatctgtggagaag
agcttcgagctgccagacggtcaagtgataaccatcggggcagagcgtttccggtgtcct
gaagttctgttccagccatccatgatcggaatggaaaatccgggaattcatgaaactact
tacaactcaatcatgaaatgtgatgtggatatcaggaaggatctttatggaaacattgtg
cttagtggtggcaccacaatgtttggcgggattggtgataggatgagtaaagaaatcacc
gcgttggcgccgagcagtatgaagatcaaagtggttgctccaccggaaaggaagtacagt
gtttggatcggtggctctatcttggcttctctcagtactttccagcagatgtggattgcg
aaagccgagtatgatgaatctggaccgtcgatcgtccacaggaagtgcttctga

DBGET integrated database retrieval system