KEGG   Arabidopsis thaliana (thale cress): AT3G47440
Entry
AT3G47440         CDS       T00041                                 
Symbol
TIP5;1
Name
(RefSeq) tonoplast intrinsic protein 5;1
  KO
K09873  aquaporin TIP
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT3G47440 (TIP5;1)
Transporters [BR:ath02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    AT3G47440 (TIP5;1)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 823898
NCBI-ProteinID: NP_190328
TAIR: AT3G47440
UniProt: Q9STX9 A0A654FI99
Position
3:17481996..17483158
AA seq 256 aa
MRRMIPTSFSSKFQGVLSMNALRCYVSEFISTFFFVLAAVGSVMSSRKLMAGDVSGPFGV
LIPAIANALALSSSVYISWNVSGGHVNPAVTFAMAVAGRISVPTAMFYWTSQMIASVMAC
LVLKVTVMEQHVPIYKIAGEMTGFGASVLEGVLAFVLVYTVFTASDPRRGLPLAVGPIFI
GFVAGANVLAAGPFSGGSMNPACAFGSAMVYGSFKNQAVYWVGPLLGGATAALVYDNVVV
PVEDDRGSSTGDAIGV
NT seq 771 nt   +upstreamnt  +downstreamnt
atgagaagaatgattccaacatcgttttcaagtaagtttcaaggagtactaagtatgaat
gcgttgagatgttatgtatcagagtttatctcaaccttcttcttcgtcctcgcagccgtt
ggttctgtcatgtcttcaaggaaattgatggctggtgatgtgtctggtccgtttggtgtt
ttaataccggcgattgctaatgcgttggcgttatcatcgtcagtttacatctcttggaac
gtctctggtggtcatgtgaatccagcggttacgtttgcgatggctgttgctggtcggatt
agcgttccaaccgctatgttttattggacttctcagatgattgcctctgttatggcttgc
cttgttcttaaagtaaccgtcatggaacagcacgtaccgatttataagattgctggagaa
atgactggatttggagcatctgttcttgaaggtgttttagctttcgtcttggtttatact
gtgttcacggctagcgatcccagacgtgggctacctttagcagtgggacctatatttata
gggtttgttgcgggagccaatgttctagccgctggtccattctctggaggttcaatgaat
cctgcgtgtgcctttgggtcggcgatggtttacggaagctttaagaaccaagctgtgtat
tgggttgggcctctgcttggaggagccacagctgctttagtgtatgataacgtggtggtc
cctgtagaagatgatcgtggttcatctactggtgatgccattggtgtgtaa

DBGET integrated database retrieval system