KEGG   Arabidopsis thaliana (thale cress): AT3G48420
Entry
AT3G48420         CDS       T00041                                 
Name
(RefSeq) Haloacid dehalogenase-like hydrolase (HAD) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like HAD Ufm1 ADH_zinc_N
Other DBs
NCBI-GeneID: 824000
NCBI-ProteinID: NP_566903
TAIR: AT3G48420
UniProt: Q94K71
Structure
Position
3:17929581..17931713
AA seq 319 aa
MATVKISLSLASLSPSSSSSSIQSKLSPSFIPNAAPAKAVKLRFNGKSLRAKPMVYRSSR
SVGVTCSASSSLTTLPSALLFDCDGVLVDTEKDGHRISFNDTFKERDLNVTWDVDLYGEL
LKIGGGKERMTAYFNKVGWPEKAPKDEAERKEFIAGLHKQKTELFMVLIEKKLLPLRPGV
AKLVDQALTNGVKVAVCSTSNEKAVSAIVSCLLGPERAEKIKIFAGDVVPKKKPDPAIYN
LAAETLGVDPSKCVVVEDSAIGLAAAKAAGMTCIVTKSGYTADEDFENADAVFDCIGDPP
EERFDLAFCGSLLRKQFVS
NT seq 960 nt   +upstreamnt  +downstreamnt
atggccactgtgaaaatctctctttccttggcttcgctatcaccatcttcttcttcttct
tcaattcaatctaagttatcaccatctttcattcccaatgcggcacctgcaaaggcggtg
aagttgcgattcaatggaaagtccctgagagcaaaaccaatggtatacagatcatctcgc
tccgttggagtcacctgctctgcttcatcttctctgacgactcttccctctgctcttctc
ttcgattgcgatggcgttcttgttgataccgagaaggacggtcacaggatctccttcaac
gacactttcaaagagagagatttgaatgttacgtgggatgttgatttatacggcgagtta
cttaaaatcggtggtggtaaagaaaggatgactgcgtattttaacaaggttggttggcca
gagaaagctcctaaagatgaagcagagaggaaagagttcatagctggacttcacaagcag
aagactgagcttttcatggttcttatcgagaaaaagctgcttccgcttcgacccggtgtt
gcaaagttggttgatcaagctttaacaaacggagtcaaagtagctgtgtgcagtacttca
aatgagaaggcggtttctgctatagtttcatgcttgcttggaccagaacgagcagagaaa
atcaagatattcgcaggagacgtagtccccaaaaagaaacctgatccagccatctacaac
ttagcagctgaaacccttggagttgatccctcaaaatgtgtagtggttgaagacagcgcg
atcgggctagcagctgcaaaagctgcgggaatgacttgtatagttacaaagagtggatac
acggctgatgaagatttcgagaacgcagatgcggttttcgactgcattggagaccctcca
gaagagagatttgatttggcattctgtggaagtcttctccggaaacagttcgttagttaa

DBGET integrated database retrieval system