KEGG   Arabidopsis thaliana (thale cress): AT3G48560
Entry
AT3G48560         CDS       T00041                                 
Symbol
CSR1
Name
(RefSeq) chlorsulfuron/imidazolinone resistant 1
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00290  Valine, leucine and isoleucine biosynthesis
ath00650  Butanoate metabolism
ath00660  C5-Branched dibasic acid metabolism
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01210  2-Oxocarboxylic acid metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ath_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AT3G48560 (CSR1)
   00660 C5-Branched dibasic acid metabolism
    AT3G48560 (CSR1)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    AT3G48560 (CSR1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT3G48560 (CSR1)
Enzymes [BR:ath01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     AT3G48560 (CSR1)
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-GeneID: 824015
NCBI-ProteinID: NP_190425
TAIR: AT3G48560
UniProt: P17597
Structure
Position
3:complement(18001283..18003749)
AA seq 670 aa
MAAATTTTTTSSSISFSTKPSPSSSKSPLPISRFSLPFSLNPNKSSSSSRRRGIKSSSPS
SISAVLNTTTNVTTTPSPTKPTKPETFISRFAPDQPRKGADILVEALERQGVETVFAYPG
GASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSSGKPGICIATSGPGATNLVSGLA
DALLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRIIEEAFF
LATSGRPGPVLVDVPKDIQQQLAIPNWEQAMRLPGYMSRMPKPPEDSHLEQIVRLISESK
KPVLYVGGGCLNSSDELGRFVELTGIPVASTLMGLGSYPCDDELSLHMLGMHGTVYANYA
VEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQ
GMNKVLENRAEELKLDFGVWRNELNVQKQKFPLSFKTFGEAIPPQYAIKVLDELTDGKAI
ISTGVGQHQMWAAQFYNYKKPRQWLSSGGLGAMGFGLPAAIGASVANPDAIVVDIDGDGS
FIMNVQELATIRVENLPVKVLLLNNQHLGMVMQWEDRFYKANRAHTFLGDPAQEDEIFPN
MLLFAAACGIPAARVTKKADLREAIQTMLDTPGPYLLDVICPHQEHVLPMIPSGGTFNDV
ITEGDGRIKY
NT seq 2013 nt   +upstreamnt  +downstreamnt
atggcggcggcaacaacaacaacaacaacatcttcttcgatctccttctccaccaaacca
tctccttcctcctccaaatcaccattaccaatctccagattctccctcccattctcccta
aaccccaacaaatcatcctcctcctcccgccgccgcggtatcaaatccagctctccctcc
tccatctccgccgtgctcaacacaaccaccaatgtcacaaccactccctctccaaccaaa
cctaccaaacccgaaacattcatctcccgattcgctccagatcaaccccgcaaaggcgct
gatatcctcgtcgaagctttagaacgtcaaggcgtagaaaccgtattcgcttaccctgga
ggtgcatcaatggagattcaccaagccttaacccgctcttcctcaatccgtaacgtcctt
cctcgtcacgaacaaggaggtgtattcgcagcagaaggatacgctcgatcctcaggtaaa
ccaggtatctgtatagccacttcaggtcccggagctacaaatctcgttagcggattagcc
gatgcgttgttagatagtgttcctcttgtagcaatcacaggacaagtccctcgtcgtatg
attggtacagatgcgtttcaagagactccgattgttgaggtaacgcgttcgattacgaag
cataactatcttgtgatggatgttgaagatatccctaggattattgaggaagctttcttt
ttagctacttctggtagacctggacctgttttggttgatgttcctaaagatattcaacaa
cagcttgcgattcctaattgggaacaggctatgagattacctggttatatgtctaggatg
cctaaacctccggaagattctcatttggagcagattgttaggttgatttctgagtctaag
aagcctgtgttgtatgttggtggtggttgtttgaattctagcgatgaattgggtaggttt
gttgagcttacggggatccctgttgcgagtacgttgatggggctgggatcttatccttgt
gatgatgagttgtcgttacatatgcttggaatgcatgggactgtgtatgcaaattacgct
gtggagcatagtgatttgttgttggcgtttggggtaaggtttgatgatcgtgtcacgggt
aagcttgaggcttttgctagtagggctaagattgttcatattgatattgactcggctgag
attgggaagaataagactcctcatgtgtctgtgtgtggtgatgttaagctggctttgcaa
gggatgaataaggttcttgagaaccgagcggaggagcttaagcttgattttggagtttgg
aggaatgagttgaacgtacagaaacagaagtttccgttgagctttaagacgtttggggaa
gctattcctccacagtatgcgattaaggtccttgatgagttgactgatggaaaagccata
ataagtactggtgtcgggcaacatcaaatgtgggcggcgcagttctacaattacaagaaa
ccaaggcagtggctatcatcaggaggccttggagctatgggatttggacttcctgctgcg
attggagcgtctgttgctaaccctgatgcgatagttgtggatattgacggagatggaagc
tttataatgaatgtgcaagagctagccactattcgtgtagagaatcttccagtgaaggta
cttttattaaacaaccagcatcttggcatggttatgcaatgggaagatcggttctacaaa
gctaaccgagctcacacatttctcggggatccggctcaggaggacgagatattcccgaac
atgttgctgtttgcagcagcttgcgggattccagcggcgagggtgacaaagaaagcagat
ctccgagaagctattcagacaatgctggatacaccaggaccttacctgttggatgtgatt
tgtccgcaccaagaacatgtgttgccgatgatcccgagtggtggcactttcaacgatgtc
ataacggaaggagatggccggattaaatactga

DBGET integrated database retrieval system