KEGG   Arabidopsis thaliana (thale cress): AT3G48560Help
Entry
AT3G48560         CDS       T00041                                 

Gene name
CSR1
Definition
(RefSeq) chlorsulfuron/imidazolinone resistant 1
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00290  Valine, leucine and isoleucine biosynthesis
ath00650  Butanoate metabolism
ath00660  C5-Branched dibasic acid metabolism
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01210  2-Oxocarboxylic acid metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ath_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AT3G48560 (CSR1)
   00660 C5-Branched dibasic acid metabolism
    AT3G48560 (CSR1)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    AT3G48560 (CSR1)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT3G48560 (CSR1)
Enzymes [BR:ath01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     AT3G48560 (CSR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M Phage_holin_2_1
Motif
Other DBs
NCBI-GeneID: 824015
NCBI-ProteinID: NP_190425
MIPS: AT3G48560.1
TAIR: AT3G48560
Araport: AT3G48560
UniProt: P17597
Structure
PDB: 

Position
3
AA seq 670 aa AA seqDB search
MAAATTTTTTSSSISFSTKPSPSSSKSPLPISRFSLPFSLNPNKSSSSSRRRGIKSSSPS
SISAVLNTTTNVTTTPSPTKPTKPETFISRFAPDQPRKGADILVEALERQGVETVFAYPG
GASMEIHQALTRSSSIRNVLPRHEQGGVFAAEGYARSSGKPGICIATSGPGATNLVSGLA
DALLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVMDVEDIPRIIEEAFF
LATSGRPGPVLVDVPKDIQQQLAIPNWEQAMRLPGYMSRMPKPPEDSHLEQIVRLISESK
KPVLYVGGGCLNSSDELGRFVELTGIPVASTLMGLGSYPCDDELSLHMLGMHGTVYANYA
VEHSDLLLAFGVRFDDRVTGKLEAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQ
GMNKVLENRAEELKLDFGVWRNELNVQKQKFPLSFKTFGEAIPPQYAIKVLDELTDGKAI
ISTGVGQHQMWAAQFYNYKKPRQWLSSGGLGAMGFGLPAAIGASVANPDAIVVDIDGDGS
FIMNVQELATIRVENLPVKVLLLNNQHLGMVMQWEDRFYKANRAHTFLGDPAQEDEIFPN
MLLFAAACGIPAARVTKKADLREAIQTMLDTPGPYLLDVICPHQEHVLPMIPSGGTFNDV
ITEGDGRIKY
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcaacaacaacaacaacaacatcttcttcgatctccttctccaccaaacca
tctccttcctcctccaaatcaccattaccaatctccagattctccctcccattctcccta
aaccccaacaaatcatcctcctcctcccgccgccgcggtatcaaatccagctctccctcc
tccatctccgccgtgctcaacacaaccaccaatgtcacaaccactccctctccaaccaaa
cctaccaaacccgaaacattcatctcccgattcgctccagatcaaccccgcaaaggcgct
gatatcctcgtcgaagctttagaacgtcaaggcgtagaaaccgtattcgcttaccctgga
ggtgcatcaatggagattcaccaagccttaacccgctcttcctcaatccgtaacgtcctt
cctcgtcacgaacaaggaggtgtattcgcagcagaaggatacgctcgatcctcaggtaaa
ccaggtatctgtatagccacttcaggtcccggagctacaaatctcgttagcggattagcc
gatgcgttgttagatagtgttcctcttgtagcaatcacaggacaagtccctcgtcgtatg
attggtacagatgcgtttcaagagactccgattgttgaggtaacgcgttcgattacgaag
cataactatcttgtgatggatgttgaagatatccctaggattattgaggaagctttcttt
ttagctacttctggtagacctggacctgttttggttgatgttcctaaagatattcaacaa
cagcttgcgattcctaattgggaacaggctatgagattacctggttatatgtctaggatg
cctaaacctccggaagattctcatttggagcagattgttaggttgatttctgagtctaag
aagcctgtgttgtatgttggtggtggttgtttgaattctagcgatgaattgggtaggttt
gttgagcttacggggatccctgttgcgagtacgttgatggggctgggatcttatccttgt
gatgatgagttgtcgttacatatgcttggaatgcatgggactgtgtatgcaaattacgct
gtggagcatagtgatttgttgttggcgtttggggtaaggtttgatgatcgtgtcacgggt
aagcttgaggcttttgctagtagggctaagattgttcatattgatattgactcggctgag
attgggaagaataagactcctcatgtgtctgtgtgtggtgatgttaagctggctttgcaa
gggatgaataaggttcttgagaaccgagcggaggagcttaagcttgattttggagtttgg
aggaatgagttgaacgtacagaaacagaagtttccgttgagctttaagacgtttggggaa
gctattcctccacagtatgcgattaaggtccttgatgagttgactgatggaaaagccata
ataagtactggtgtcgggcaacatcaaatgtgggcggcgcagttctacaattacaagaaa
ccaaggcagtggctatcatcaggaggccttggagctatgggatttggacttcctgctgcg
attggagcgtctgttgctaaccctgatgcgatagttgtggatattgacggagatggaagc
tttataatgaatgtgcaagagctagccactattcgtgtagagaatcttccagtgaaggta
cttttattaaacaaccagcatcttggcatggttatgcaatgggaagatcggttctacaaa
gctaaccgagctcacacatttctcggggatccggctcaggaggacgagatattcccgaac
atgttgctgtttgcagcagcttgcgggattccagcggcgagggtgacaaagaaagcagat
ctccgagaagctattcagacaatgctggatacaccaggaccttacctgttggatgtgatt
tgtccgcaccaagaacatgtgttgccgatgatcccgagtggtggcactttcaacgatgtc
ataacggaaggagatggccggattaaatactga

DBGET integrated database retrieval system