KEGG   Arabidopsis thaliana (thale cress): AT3G49660Help
Entry
AT3G49660         CDS       T00041                                 

Gene name
WDR5a
Definition
(RefSeq) Transducin/WD40 repeat-like superfamily protein
  KO
K14963  COMPASS component SWD3
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ath03036]
    AT3G49660 (WDR5a)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     AT3G49660 (WDR5a)
   HMT complexes
    COMPASS/SET1 complex
     AT3G49660 (WDR5a)
    COMPASS/SET1 complex (yeast)
     AT3G49660 (WDR5a)
    MLL-HCF complex
     AT3G49660 (WDR5a)
    MLL3/MLL4 complex
     AT3G49660 (WDR5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 eIF2A WD40_like Ge1_WD40 PALB2_WD40
Motif
Other DBs
NCBI-GeneID: 824128
NCBI-ProteinID: NP_190535
MIPS: AT3G49660.1
TAIR: AT3G49660
Araport: AT3G49660
UniProt: Q9M2Z2 A0A178VK59
Position
3
AA seq 317 aa AA seqDB search
MAEEIPATASFTPYVHSQTLTSHNRAVSSVKFSSDGRLLASASADKTIRTYTINTINDPI
AEPVQEFTGHENGISDVAFSSDARFIVSASDDKTLKLWDVETGSLIKTLIGHTNYAFCVN
FNPQSNMIVSGSFDETVRIWDVTTGKCLKVLPAHSDPVTAVDFNRDGSLIVSSSYDGLCR
IWDSGTGHCVKTLIDDENPPVSFVRFSPNGKFILVGTLDNTLRLWNISSAKFLKTYTGHV
NAQYCISSAFSVTNGKRIVSGSEDNCVHMWELNSKKLLQKLEGHTETVMNVACHPTENLI
ASGSLDKTVRIWTQKKE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggaaattccagcaacagcatcattcactccatacgtccattcacaaactcta
acatctcacaatcgcgccgtctcctccgtgaaattctcctccgatggacgtctcctcgca
tccgcctccgccgacaaaacaatccgcacttacacaatcaacaccattaacgatccaatc
gccgagcccgtacaagaattcaccggccatgaaaacggtatctccgatgttgcattctct
tcagacgcgaggtttatagtctcagcttccgatgacaaaaccttaaagctatgggacgtt
gaaactggttcattgatcaagacgcttattggacacactaattacgccttctgtgtcaat
ttcaatcctcaatcaaatatgattgtatctggttcgtttgatgaaactgttcggatctgg
gatgtcactactggaaagtgtttgaaagttcttcccgcgcattctgatcctgttactgct
gttgattttaatagagatgggtctctcattgtttcgagtagctatgatgggttgtgtcgt
atatgggattctgggactggtcattgtgtgaaaactctgattgatgatgagaatcctcct
gtttcgtttgttagattctctcctaatggcaagtttatcctcgttggtacacttgataac
acgctgaggttgtggaacatttcgtctgctaagttcctcaaaacatacactggccacgtg
aacgcacagtattgcatttcctctgcgttctccgtcacaaatggaaagcgaatagtcagt
ggatccgaggacaactgtgtacacatgtgggagctaaactccaagaaactgctacagaaa
cttgagggtcatactgagaccgtcatgaacgtagcatgccacccgacagagaacttgatc
gcatcaggctcgctcgacaagacagtaaggatttggacacagaagaaagaataa

DBGET integrated database retrieval system