KEGG   Arabidopsis thaliana (thale cress): AT3G50420Help
Entry
AT3G50420         CDS       T00041                                 

Definition
(RefSeq) Pentatricopeptide repeat (PPR) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR PPR_1 PPR_3 PPR_long
Motif
Other DBs
NCBI-GeneID: 824206
NCBI-ProteinID: NP_190611
MIPS: AT3G50420.1
TAIR: AT3G50420
Araport: AT3G50420
UniProt: Q9SCT2
Position
3
AA seq 794 aa AA seqDB search
MTRGSMKRSVLFVETDAAAEYPYANNNLISMYVRCSSLEQARKVFDKMPQRNIVTLFGLS
AVFEYVSMGSSLHSQIIKLGSFQMIFFMPLNEIASSVVELTRKCVSITVLKRARQIHALV
LTAGAGAATESPYANNNLISMYVRCGSLEQARKVFDKMPHRNVVSYNALYSAYSRNPDFA
SYAFPLTTHMAFEYVKPNSSTFTSLVQVCAVLEDVLMGSSLNSQIIKLGYSDNVVVQTSV
LGMYSSCGDLESARRIFDCVNNRDAVAWNTMIVGSLKNDKIEDGLMFFRNMLMSGVDPTQ
FTYSIVLNGCSKLGSYSLGKLIHARIIVSDSLADLPLDNALLDMYCSCGDMREAFYVFGR
IHNPNLVSWNSIISGCSENGFGEQAMLMYRRLLRMSTPRPDEYTFSAAISATAEPERFVH
GKLLHGQVTKLGYERSVFVGTTLLSMYFKNREAESAQKVFDVMKERDVVLWTEMIVGHSR
LGNSELAVQFFIEMYREKNRSDGFSLSSVIGACSDMAMLRQGEVFHCLAIRTGFDCVMSV
CGALVDMYGKNGKYETAETIFSLASNPDLKCWNSMLGAYSQHGMVEKALSFFEQILENGF
MPDAVTYLSLLAACSHRGSTLQGKFLWNQMKEQGIKAGFKHYSCMVNLVSKAGLVDEALE
LIEQSPPGNNQAELWRTLLSACVNTRNLQIGLYAAEQILKLDPEDTATHILLSNLYAVNG
RWEDVAEMRRKIRGLASSKDPGLSWIEVNNNNTQVFSSGDQSNPEVVSQAQDELNRLKRN
MLCKSSFNKLVCSN
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgacgagaggttcgatgaaacgcagcgtattgtttgtagagacagacgccgctgccgag
tatccgtacgcaaataacaatctcatatcgatgtacgtgaggtgtagttcgctggaacaa
gcacggaaagtgttcgacaaaatgcctcagagaaacattgtaactctattcggacttagt
gctgtatttgagtatgtttccatgggatcatcactgcattcgcagattataaagcttgga
tcttttcagatgatcttttttatgccactgaacgaaatagcttcttccgttgtagaactt
acacggaaatgcgtctcgatcacggtactaaaacgggcgcgtcagatccacgctctcgtc
ctcaccgccggcgctggcgccgctaccgagtctccgtacgcaaataacaatctcatctca
atgtatgtgaggtgtggttcactggaacaagcacggaaagtgttcgacaaaatgcctcac
agaaacgtagtttcttataatgcgctttattcggcgtattcccggaacccagattttgca
agttatgcgtttcctctaacaacccatatggcgtttgagtacgtgaagcccaatagttca
actttcactagcttagtgcaagtatgtgctgtgcttgaggatgttttaatggggtcatca
ttaaactcgcagattataaagcttggttattcagataatgtagttgtccagacatcggtt
ttggggatgtactctagttgcggggacttagaatctgcgaggagaatatttgactgtgta
aataatagagatgcggttgcttggaacacaatgatagttgggagtttgaaaaatgataag
atagaagatgggcttatgttctttcgaaacatgttgatgtctggtgttgatccaacgcag
ttcacgtattcgattgtgttgaatggttgtagtaaattgggaagctattcactggggaaa
ctaatccatgcccggataatagtctctgatagtttagctgatttacctctagataatgct
cttcttgacatgtattgcagttgtggagacatgagggaagcattttatgtgtttgggagg
attcataacccaaatttggtttcatggaactcgattatttcagggtgctcagaaaacggc
tttggagagcaagcgatgcttatgtatagaaggttgctgaggatgtccacacctcggccg
gatgaatatactttctctgctgctatatctgcgacagcggaaccagaaagatttgttcat
gggaagcttcttcacggacaagtaacgaaattaggatatgaaaggagtgtttttgttgga
acaacactattgtcgatgtacttcaagaacagggaagctgaatctgcacagaaggtgttt
gatgtgatgaaggaaagggatgttgttctctggactgagatgatcgtagggcattctaga
ttaggaaacagcgaattagcggtccaattcttcattgaaatgtacagagaaaagaataga
agtgatggtttttccctgagtagtgtcataggagcatgttcagatatggcaatgctaaga
caaggtgaagttttccattgtcttgccataaggacgggattcgattgtgttatgtcagta
tgtggagcgctagtagacatgtatgggaaaaacggtaaatacgaaactgcagaaacaata
ttctctcttgcttcaaatccagatttgaaatgttggaattcgatgctaggtgcttatagt
cagcatggaatggtagaaaaagctctgagcttcttcgagcaaatactagaaaacggattc
atgccagatgctgttacatacttgtctttattagcagcctgtagccacaggggatcaacg
ttgcaaggtaagttcctatggaaccaaatgaaggaacagggcatcaaagcagggtttaag
cactactcttgcatggtgaatttagtatcaaaagctgggttagtagacgaggcactggaa
ctgatagaacaatctcctcccgggaacaaccaagcagagctctggagaactctgctaagc
gcatgtgttaacacaagaaacttgcagataggactatatgcagctgagcaaatactgaaa
cttgatccagaagacactgcaacacacattctactatcaaatttatatgcagtaaatggg
agatgggaggatgttgcagagatgagaaggaagattagaggattagcttcatctaaagat
ccaggattgagctggattgaagtgaacaacaacaatacacaagttttctcctcaggagac
cagtcgaacccagaagttgtaagtcaagctcaagatgaattaaatagattaaagagaaat
atgttgtgcaaatcatcattcaataaacttgtctgttcaaattaa

DBGET integrated database retrieval system