KEGG   Arabidopsis thaliana (thale cress): AT3G51840Help
Entry
AT3G51840         CDS       T00041                                 

Gene name
ACX4
Definition
(RefSeq) acyl-CoA oxidase 4
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00071  Fatty acid degradation
ath00592  alpha-Linolenic acid metabolism
ath01040  Biosynthesis of unsaturated fatty acids
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01212  Fatty acid metabolism
ath04146  Peroxisome
Module
ath_M00087  beta-Oxidation
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    AT3G51840 (ACX4)
   00592 alpha-Linolenic acid metabolism
    AT3G51840 (ACX4)
   01040 Biosynthesis of unsaturated fatty acids
    AT3G51840 (ACX4)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    AT3G51840 (ACX4)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     AT3G51840 (ACX4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M
Motif
Other DBs
NCBI-GeneID: 824347
NCBI-ProteinID: NP_190752
MIPS: AT3G51840.1
TAIR: AT3G51840
Araport: AT3G51840
UniProt: Q96329
Structure
PDB: 

Position
3
AA seq 436 aa AA seqDB search
MAVLSSADRASNEKKVKSSYFDLPPMEMSVAFPQATPASTFPPCTSDYYHFNDLLTPEEQ
AIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSIKGYGCPGLSITANAI
ATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQLNTVACWALTEPDNG
SDASGLGTTATKVEGGWKINGQKRWIGNSTFADLLIIFARNTTTNQINGFIVKKDAPGLK
ATKIPNKIGLRMVQNGDILLQNVFVPDEDRLPGVNSFQDTSKVLAVSRVMVAWQPIGISM
GIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAMFLMGWRLCKLYETGQMTPGQ
ASLGKAWISSKARETASLGRELLGGNGILADFLVAKAFCDLEPIYTYEGTYDINTLVTGR
EVTGIASFKPATRSRL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgctttcatctgcagatcgagctagtaatgagaagaaggtgaagagttcatac
tttgatttgccacctatggaaatgtctgtagcatttcctcaagcaactccagcctctaca
tttccaccttgtacttcagactattatcatttcaatgatctactgactccggaagaacaa
gctatccggaagaaagtgagggaatgcatggagaaagaagttgctccaataatgacagag
tactgggagaaagcagaatttccattccatatcactccaaagcttggggctatgggtgtt
gctggtggctcgatcaagggttatggatgtcctggtctctccatcaccgccaatgcaatt
gccacagcagaaatagctagagttgatgcaagttgttcgactttcattttggtgcattct
tctttgggcatgctcactattgcactctgtggatcagaagcacagaaggagaagtatttg
ccttctttggctcaattgaatactgtggcttgttgggctttgacagagcccgacaatgga
agcgatgcaagtggtctaggaacgactgcaacaaaggttgaaggaggttggaaaattaat
ggacaaaagcgttggattggaaacagcacctttgcagatctgttgatcatctttgcgagg
aatacaacaactaaccaaatcaacggattcatagtcaagaaagatgcgcctggcctaaag
gctactaagatcccaaataaaataggtttacgtatggttcaaaatggagatattctacta
cagaatgtctttgttccagatgaggatcggttacctggggtaaattcttttcaggacacc
agcaaggttctggctgtctcacgtgtaatggtggcctggcaaccaatcggcatatcaatg
ggaatctacgatatgtgccacaggtatctgaaggagaggaaacagtttggagcaccgttg
gctgctttccagttaaaccaacagaagcttgtgcagatgctgggtaacgttcaagcgatg
tttctaatgggttggcgtctctgcaagctgtatgagacgggtcagatgactccaggtcaa
gccagtttaggaaaggcatggatttcatcaaaagcgagagaaactgcttcgctaggtcgg
gaattacttggtgggaatggaattctagcagattttctggtagcaaaggctttctgtgac
cttgaacccatttatacatacgaagggacttatgatataaacaccttagtaacagggagg
gaagtaacgggtattgcgagtttcaaaccggctacacgtagccgtctctaa

DBGET integrated database retrieval system