KEGG   Arabidopsis thaliana (thale cress): AT3G51870Help
Entry
AT3G51870         CDS       T00041                                 

Definition
(RefSeq) Mitochondrial substrate carrier family protein
  KO
K14684  solute carrier family 25 (mitochondrial phosphate transporter), member 23/24/25/41
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT3G51870
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   AT3G51870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 824350
NCBI-ProteinID: NP_190755
MIPS: AT3G51870.1
TAIR: AT3G51870
Araport: AT3G51870
UniProt: O65023
Position
3
AA seq 381 aa AA seqDB search
MEEDRAILTFHRIPSLNSSLITTSSPAKSGAEQFRRRVLRNPARGDFGLGRFACISLVEK
CEQREFAPTTAQLLNNPLAILALVPKDAAIFAAGALAGAAAKTVTAPLDRIKLLMQTHGI
RLGQQSAKKAIGFIEAITLIAKEEGVKGYWKGNLPQVIRVLPYSAVQLLAYESYKNLFKG
KDDQLSVIGRLAAGACAGMTSTLLTYPLDVLRLRLAVEPGYRTMSQVALSMLRDEGIASF
YYGLGPSLVGIAPYIAVNFCIFDLVKKSLPEEYRKKAQSSLLTAVLSAGIATLTCYPLDT
VRRQMQMRGTPYKSIPEAFAGIIDRDGLIGLYRGFLPNALKTLPNSSIRLTTFDMVKRLI
ATSEKQLQKISDDNRNRDQAQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagacagagcgattctcacttttcaccgtatcccttccctcaattcctcctta
ataacaacctcttctccggccaaatccggcgccgaacagtttcgccgccgtgttctgcga
aatccagctcgcggagatttcggtttaggtagattcgcgtgcatttcactcgtggagaag
tgcgaacagagagaattcgctccgacgacagctcagctcttgaacaatcctctagctatt
cttgctcttgtccctaaggatgcagctatttttgccgccggtgctcttgccggagccgcc
gctaaaactgttactgctcctcttgaccgtatcaaacttcttatgcagacacatggtata
agacttggacaacagagtgcgaagaaggcgataggatttatcgaggcaatcactttgata
gctaaagaagaaggagttaaaggttattggaaaggaaatttacctcaggtgataagagtg
ttaccttacagtgcggtccagcttttggcttatgagagttacaagaacttgttcaaaggt
aaagatgatcagctctcagtaatcggaagacttgcagctggtgcttgtgctggcatgaca
tctactttgttgacataccctctagatgttttgagattgaggttggctgtcgaacctggg
tatcgaacaatgtctcaggttgctttgagtatgctccgtgatgaaggaatcgcatctttc
tattacggtctaggaccttctctagtggggatagctccatatattgctgtaaacttttgt
attttcgatctggtgaagaagtctttaccggaggaatatagaaagaaggcacaatcgtct
ctattaacagctgttctctcagctggtattgcaacactgacatgttaccctctagacact
gtgagacggcaaatgcaaatgagaggaactccatacaaatcaattccggaggcatttgct
ggaattatagaccgtgatgggcttataggcttgtaccgcggctttttacccaatgcattg
aaaactctaccaaacagcagtattaggcttacaaccttcgacatggtaaagcgccttatc
gccacaagtgagaagcagcttcaaaagatcagcgatgataatcggaatcgagaccaagct
caataa

DBGET integrated database retrieval system