KEGG   Arabidopsis thaliana (thale cress): AT3G52150
Entry
AT3G52150         CDS       T00041                                 
Symbol
PSRP2
Name
(RefSeq) RNA-binding (RRM/RBD/RNP motifs) family protein
  KO
K13126  polyadenylate-binding protein
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03015  mRNA surveillance pathway
ath03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    AT3G52150 (PSRP2)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AT3G52150 (PSRP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT3G52150 (PSRP2)
   03041 Spliceosome [BR:ath03041]
    AT3G52150 (PSRP2)
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     AT3G52150 (PSRP2)
   mRNA cycle factors
    Stress granule specific factors
     AT3G52150 (PSRP2)
Spliceosome [BR:ath03041]
 Complex C
  Other components
   Complex C specific factors
    AT3G52150 (PSRP2)
SSDB
Motif
Pfam: RRM_1 RRM_occluded RRM_7 RRM_5 RRM_8 DbpA
Other DBs
NCBI-GeneID: 824379
NCBI-ProteinID: NP_566958
TAIR: AT3G52150
UniProt: Q8VYM4 A0A178VFQ5
Position
3:19342014..19343466
AA seq 253 aa
MATFLTNVVSIKPTIFSFQSESFTPLHTRVNVFSSKPFPSLAGTFSRSSRTRFIPYAVTE
TEEKPAALDPSSEAARRVYIGNIPRTVTNEQLTKLVEEHGAVEKVQVMYDKYSGRSRRFG
FATMKSVEDANAVVEKLNGNTVEGREIKVNITEKPIASSPDLSVLQSEDSAFVDSPYKVY
VGNLAKTVTKEMLENLFSEKGKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNN
SLLEGQKIRVNKA
NT seq 762 nt   +upstreamnt  +downstreamnt
atggcgactttcctaacaaatgttgtttcaatcaaacctacaatcttctcattccagtcc
gaatccttcactcctttgcatacacgggtcaatgtattctcctcgaaaccctttccttct
ctcgctggaactttctcccggagctctagaacgagattcattccttatgctgtaacggag
acggaagaaaaacccgccgctttggaccctagttcagaagctgccaggcgtgtgtatatc
ggtaacatacccaggacggtgaccaatgagcagctcactaaacttgttgaagaacacggt
gctgttgaaaaagttcaggtgatgtatgataagtattcaggaagaagccgtcgatttggg
tttgctacaatgaaatcagttgaagatgctaatgctgtggttgagaaattgaatggcaat
accgttgaagggcgtgagataaaggttaacattacagagaaacctatagcatcatcacct
gatttatcagttcttcagtctgaggattcagcatttgtagatagcccttacaaagtgtat
gttgggaatctagcaaagactgttacaaaagagatgcttgagaatttgttttctgagaaa
gggaaagtagtaagtgctaaggtttcaagagtacctggaacttccaaatccaccgggttt
ggattcgttacgttttcttctgaagaagatgtggaagcagccattgttgctcttaacaat
tcgttgctggaaggacagaagattcgggtgaataaggcttag

DBGET integrated database retrieval system