KEGG   Arabidopsis thaliana (thale cress): AT3G52850Help
Entry
AT3G52850         CDS       T00041                                 

Gene name
VSR1
Definition
(RefSeq) vacuolar sorting receptor homolog 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PA EGF_CA cEGF
Motif
Other DBs
NCBI-GeneID: 824451
NCBI-ProteinID: NP_190853
MIPS: AT3G52850.1
TAIR: AT3G52850
Araport: AT3G52850
UniProt: P93026
Structure
PDB: 

Position
3
AA seq 623 aa AA seqDB search
MKLGLFTLSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTV
VYPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADS
KAEPLITMDTPEEDKSDADYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESVP
HPDERVEYELWTNSNDECGKKCDTQIEFLKNFKGAAQILEKGGHTQFTPHYITWYCPEAF
TLSKQCKSQCINHGRYCAPDPEQDFTKGYDGKDVVVQNLRQACVYRVMNDTGKPWVWWDY
VTDFAIRCPMKEKKYTKECADGIIKSLGIDLKKVDKCIGDPEADVENPVLKAEQESQIGK
GSRGDVTILPTLVVNNRQYRGKLEKGAVLKAMCSGFQESTEPAICLTEDLETNECLENNG
GCWQDKAANITACRDTFRGRLCECPTVQGVKFVGDGYTHCKASGALHCGINNGGCWRESR
GGFTYSACVDDHSKDCKCPLGFKGDGVKNCEDVDECKEKTVCQCPECKCKNTWGSYECSC
SNGLLYMREHDTCIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAEIR
GIMAQYMPLESQPPNTSGHHMDI
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgggcttttcactctctcgtttcttctgatcttgaatctagcaatgggtaga
ttcgttgttgagaagaacaatctcaaagttacatcacctgattcgatcaaaggtatttac
gaatgtgccattggtaatttcggagttcctcaatacggtggtactttagtcggcaccgtc
gtctatcctaaatccaatcagaaagcttgtaaaagctactccgatttcgatatctccttc
aaatccaaacctggacgattaccaacttttgtccttatcgatcgtggagattgttacttc
actttgaaagcatggatagctcaacaagctggagcagcagcgatacttgtagctgatagt
aaagctgagccattgattacaatggatacacctgaagaagataaatctgatgcggattat
cttcagaacattaccattccttctgctctcattactaaaacattgggagacagtataaag
tctgctctttccggtggtgatatggttaacatgaagctagattggactgagtcggttcca
catcctgatgagcgtgtagagtatgaactgtggactaatagcaatgacgagtgtgggaag
aagtgtgatactcagattgagtttctcaagaattttaaaggagctgctcagattcttgag
aaaggtgggcatactcagttcacgccacattatattacttggtactgtcctgaagcgttt
acgttgagtaaacagtgtaagtctcagtgcatcaaccatggaaggtattgtgcgcctgat
cctgagcaggattttacgaaagggtatgatggaaaggatgttgttgttcagaatctacgt
caggcttgtgtctacagagtgatgaatgataccggtaagccgtgggtctggtgggactat
gtgactgactttgctatccggtgtccaatgaaggagaagaagtacaccaaggaatgcgca
gatggaattattaagtcccttggcattgatctcaaaaaggtggacaagtgtatcggagac
cctgaagcagatgtggagaacccagttcttaaagcagagcaggagtcacagataggcaaa
ggttcccgtggagacgtgactatactcccaactcttgtcgtgaacaacagacaatacaga
ggtaaattggaaaagggggcagtgcttaaggctatgtgttcgggttttcaagagtcaacg
gaaccagctatctgtcttactgaagatttggaaactaatgaatgtttggaaaacaacggt
ggatgctggcaagacaaagctgccaacattactgcatgcagggatacttttaggggaaga
ttgtgtgagtgccctactgttcaaggtgttaaattcgttggtgacggttacactcactgc
aaagcctctggagctttgcattgtggtatcaacaatggaggatgctggagagaatcccga
ggtggcttcacttactctgcttgcgtagatgatcattcaaaggattgcaaatgcccactt
gggttcaagggcgatggagtgaagaactgtgaagatgtggacgagtgcaaagaaaaaacg
gtgtgccagtgcccagagtgtaaatgtaaaaacacttggggaagttatgaatgcagctgc
agcaacggtttgctttacatgcgtgagcacgacacttgcataggttcaggcaaagttgga
accacaaaactcagctggagctttttgtggatccttataatcggggtgggtgttgcaggt
ctttctggatatgcagtctacaaatacagaatcaggagttacatggatgcggaaattaga
gggatcatggcacagtacatgccattggaaagtcaaccacccaacacaagtggtcaccat
atggatatatga

DBGET integrated database retrieval system