KEGG   Arabidopsis thaliana (thale cress): AT3G52930Help
Entry
AT3G52930         CDS       T00041                                 

Gene name
FBA8
Definition
(RefSeq) Aldolase superfamily protein
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00030  Pentose phosphate pathway
ath00051  Fructose and mannose metabolism
ath00710  Carbon fixation in photosynthetic organisms
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ath_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
ath_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ath_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
ath_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT3G52930 (FBA8)
   00030 Pentose phosphate pathway
    AT3G52930 (FBA8)
   00051 Fructose and mannose metabolism
    AT3G52930 (FBA8)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AT3G52930 (FBA8)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     AT3G52930 (FBA8)
Membrane trafficking [BR:ath04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AT3G52930 (FBA8)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    AT3G52930 (FBA8)
Exosome [BR:ath04147]
 Exosomal proteins
  Proteins found in most exosomes
   AT3G52930 (FBA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 824459
NCBI-ProteinID: NP_190861
MIPS: AT3G52930.1
TAIR: AT3G52930
Araport: AT3G52930
UniProt: Q9LF98 A0A178V8L4
Position
3
AA seq 358 aa AA seqDB search
MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRNLRELLF
TAPGALPCLSGVILFEETLYQKSSDGKLFVDILKEGGVLPGIKVDKGTVELAGTDGETTT
QGLDGLGDRCKKYYEAGARFAKWRAVLKIGENEPSEHSIHENAYGLARYAVICQENGLVP
IVEPEILVDGSHDIQKCAAVTERVLAACYKALSDHHVLLEGTLLKPNMVTPGSDSPKVSP
EVIAEHTVRALQRTVPAAVPAIVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRAL
QQSTLKTWAGKEENVKAAQEALYVRCKANSEATLGTYKGDAKLGDGAAESLHVKDYKY
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccttcacaagcaaattcgccgatgagttgatcgccaacgctgcctacatcggc
acacctggaaaaggtattttggctgctgatgagtccactggtaccattggaaagcgtctt
gcgagcatcaacgtcgagaacgttgagaccaacagacgtaacctccgtgagcttctcttc
accgcccctggtgctcttccatgcctcagtggtgtcatccttttcgaagagactctgtac
caaaagagttccgatggtaagcttttcgttgatatcttgaaggaaggaggagttcttccc
ggtatcaaggttgacaagggtaccgttgagctagctggaaccgacggtgagaccaccact
caaggtcttgacggtctcggtgacagatgcaagaagtactacgaagctggtgctcgtttc
gccaagtggcgtgcagtcctcaagatcggagagaacgagccatctgagcattccattcat
gagaacgcttacggattagctagatacgctgttatctgccaagagaacggtcttgtacca
attgtcgagcctgagatcctagtcgatggatcccatgacatccagaagtgtgctgccgtg
actgagcgtgtccttgcagcttgctacaaggctcttagcgaccaccacgtcttgctcgag
ggtacactcttgaagcctaacatggttactcccggatctgacagccccaaggtttcacct
gaagtcatcgctgagcacaccgtccgtgcccttcagagaaccgtcccagcagctgttcca
gccattgtcttcttatctggaggacagagcgaggaagaagctaccaggaacttgaacgcc
atgaaccagttgaagaccaagaagccatggtcattgtctttctcattcggacgtgcgttg
cagcagtctaccttgaagacatgggcaggtaaagaggagaatgtcaaggcagctcaagag
gcgttgtatgtgaggtgcaaggctaactctgaagccacactcggaacctacaagggtgac
gctaagcttggtgatggagcagctgagagccttcacgtgaaggattacaagtactga

DBGET integrated database retrieval system