KEGG   Arabidopsis thaliana (thale cress): AT3G52940
Entry
AT3G52940         CDS       T00041                                 

Gene name
FK
Definition
(RefSeq) Ergosterol biosynthesis ERG4/ERG24 family
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00100  Steroid biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    AT3G52940 (FK)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     AT3G52940 (FK)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 824460
NCBI-ProteinID: NP_566975
MIPS: AT3G52940.1
TAIR: AT3G52940
UniProt: Q9LDR4 A0A654FGX0 Q0WUH0
Position
3
AA seq 369 aa
MLLDMDLGVLLPSLQSVYVLVFYFVYLAVAGEILPGKVIRGVLLSDGSQLRYRCNGLLAL
ILLVAILGICAKLGIVSPLVVADRGLELLSATFIFCVLVTLALYVTGRSSSNKGSSLKPH
VSGNLVHDWWFGIQLNPQFMSIDLKFFFVRAGMMGWLLINLSILAKSVQDGSLSQSMILY
QIFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLLWIPFTFSIQGWWLLHNKVELT
VPAIVVNCLVFLIGYMVFRGANKQKHIFKKNPKTPIWGKPPVVVGGKLLVSGYWGIARHC
NYLGDLMLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEVRCAEKYKEIWAEYLRLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgctgctagatatggatctcggtgttcttcttccatcattgcaatctgtttatgtgctg
gtgttttacttcgtttacttggccgttgccggagaaattctccccgggaaagttattcgc
ggcgtccttttatcagatggctctcaacttcgttaccgatgcaatggtctattggcacta
atattgttggtagctattttgggaatctgtgcaaaacttggcattgtatcacctcttgtg
gttgcggatagaggacttgagttactctcagctacttttattttctgtgttttggtgaca
ttagcattgtatgttactgggcgaagttcctcgaataagggttcttccctaaagcctcat
gtctcaggaaatcttgtacatgactggtggtttggaatacagctgaatcctcagtttatg
agcattgatctcaagtttttctttgtcagagccgggatgatgggatggctgcttatcaat
ctctctattctggcaaaaagtgtgcaggatggttccttgagtcagtcgatgattctttac
cagatcttctgtgcgttatatatattggactactttgttcatgaagaatacatgacctct
acgtgggacataattgcagagagactaggcttcatgctagtgtttggagatctcctgtgg
attcctttcacttttagcattcagggctggtggcttttgcacaacaaagtagaactaaca
gttcctgcgattgtagtcaattgccttgtcttcttgatagggtacatggtttttcgagga
gctaacaaacaaaaacatatctttaagaagaacccaaaaacaccaatatggggcaagcct
ccagtggtagttggtggaaagttactggtttcaggctattggggaattgcaaggcactgt
aattaccttggcgacttgatgcttgctctgtccttcagtttgccatgtggaataagttct
ccggttccatatttctacccgatataccttctgatactattgatatggagagaacgaaga
gacgaggttcgatgtgcagagaagtacaaggagatatgggcagagtatcttagacttgtc
ccctggagaatacttccttatgtttattag

DBGET integrated database retrieval system