KEGG   Arabidopsis thaliana (thale cress): AT3G53750
Entry
AT3G53750         CDS       T00041                                 

Gene name
ACT3
Definition
(RefSeq) actin 3
  KO
K10355  actin, other eukaryote
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ath04812]
    AT3G53750 (ACT3)
Cytoskeleton proteins [BR:ath04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     AT3G53750 (ACT3)
SSDB
Motif
Pfam: Actin Methyltransf_29
Other DBs
NCBI-GeneID: 824542
NCBI-ProteinID: NP_001326881
MIPS: AT3G53750.1
TAIR: AT3G53750
UniProt: P0CJ46 P0CJ47 A0A384LCZ9 A0A178VSL1
Position
3
AA seq 377 aa
MADGEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEA
QSKRGILTLKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREK
MTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRL
DLAGRDLTDALMKILTERGYSFTTTAEREIVRDIKEKLCYIALDYEQELETAKTSSSVEK
NYELPDGQVITIGSERFRCPEVLYQPSMIGMENAGIHETTYNSIMKCDVDIRKDLYGNIV
LSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIA
KAEYDESGPSIVHRKCF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggctgatggtgaagatattcaaccccttgtctgtgacaatggaactggaatggttaag
gctggttttgctggggatgatgcaccgagggctgtgtttccaagtattgttggccgtcct
cgccacactggagtgatggttggaatgggacagaaggatgcatatgttggcgatgaagct
caatccaagcgtggtattcttacccttaaataccctattgagcacggtattgtcaacaat
tgggatgatatggaaaaaatctggcatcatactttctacaatgagctccgtgttgctccc
gaggagcatcctattctgctcactgaagcgcctcttaacccaaaggctaaccgtgagaag
atgactcagatcatgtttgaaacctttaacgctccggctatgtatgtcgccattcaagct
gtcctgtcgctttatgctagtggtcgtactactggtattgtgcttgactctggagatggt
gtgagtcacacggtccctatctatgagggttacgctctcccgcatgcaatcctacgtctt
gatcttgcaggtcgtgacctcacagatgctctgatgaagatcctcactgagcgtggttac
tctttcaccacaacagctgagcgtgaaattgtcagagacatcaaggagaagctttgctac
attgctcttgactatgagcaggagcttgagacggctaaaaccagctcttctgtagagaag
aactatgagttacctgatgggcaagtgatcaccattggatctgagcgtttccgttgccct
gaggttctttaccagccatctatgatcggtatggagaatgctggtatccatgaaaccacc
tacaactccataatgaaatgtgatgttgacatcagaaaggacttgtatggtaacattgtg
ctcagtggtggaacaactatgttccctggaattgctgacagaatgagcaaagagatcact
gctttggcaccgagcagcatgaagatcaaagtcgttgcacctcctgagaggaaatactct
gtctggattggaggatccatcttggcctccctcagtaccttccagcagatgtggatcgca
aaggcagaatatgatgagtcaggcccgtcgattgttcaccggaaatgcttttga

DBGET integrated database retrieval system