KEGG   Arabidopsis thaliana (thale cress): AT3G54050
Entry
AT3G54050         CDS       T00041                                 
Symbol
HCEF1
Name
(RefSeq) high cyclic electron flow 1
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00030  Pentose phosphate pathway
ath00051  Fructose and mannose metabolism
ath00710  Carbon fixation by Calvin cycle
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
ath_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ath_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT3G54050 (HCEF1)
   00030 Pentose phosphate pathway
    AT3G54050 (HCEF1)
   00051 Fructose and mannose metabolism
    AT3G54050 (HCEF1)
  09102 Energy metabolism
   00710 Carbon fixation by Calvin cycle
    AT3G54050 (HCEF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT3G54050 (HCEF1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     AT3G54050 (HCEF1)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT3G54050 (HCEF1)
SSDB
Motif
Pfam: FBPase FBPase_C tRNA_NucTransf2
Other DBs
NCBI-GeneID: 824572
NCBI-ProteinID: NP_190973
TAIR: AT3G54050
UniProt: P25851 A0A654FGI2
Position
3:20016837..20018822
AA seq 417 aa
MAATAATTTSSHLLLSSSRHVASSSQPSILSPRSLFSNNGKRAPTGVRNHQYASGVRCMA
VAADAAETKTAARKKSGYELQTLTGWLLRQEMKGEIDAELTIVMSSISLACKQIASLVQR
AGISNLTGVQGAVNIQGEDQKKLDVISNEVFSNCLRSSGRTGIIASEEEDVPVAVEESYS
GNYVVVFDPLDGSSNIDAAVSTGSIFGIYSPNDECIVDDSDDISALGSEEQRCIVNVCQP
GNNLLAAGYCMYSSSVIFVLTLGKGVFSFTLDPMYGEFVLTQENIEIPKAGRIYSFNEGN
YQMWDDKLKKYIDDLKDPGPTGKPYSARYIGSLVGDFHRTLLYGGIYGYPRDAKSKNGKL
RLLYECAPMSFIVEQAGGKGSDGHSRVLDIQPTEIHQRVPLYIGSTEEVEKLEKYLA
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcagcaaccgccgcaacaacgacgtcgtctcaccttcttctctcaagctcacgtcac
gtggcatcatcatcccagccttcaatcctttcaccgagatctctcttctccaacaacggg
aaacgagcaccaactggagtgaggaaccatcagtatgcgagtggagtgaggtgtatggcc
gtagcggcggatgctgctgagacgaaaacggcggcgaggaagaagagtggatacgaactt
caaacgttgacgggctggttgctgagacaagagatgaaaggagagatagatgcagagctg
acgatagtgatgtcgagtatatcattggcttgtaagcagatcgcttcacttgttcaacgt
gccggaatctctaacctgaccggagttcaaggcgccgttaatattcagggagaggatcag
aagaagcttgacgtcatctctaatgaggtgttttccaactgtttgagatcaagtggaaga
acgggaatcatagcctcggaggaagaggacgtgccagttgcggtggaggagagttactcc
ggcaactacgtcgtcgtgtttgaccctcttgatggttcctccaacattgacgctgccgtc
tctactggttctatcttcggtatctatagccccaatgacgaatgcattgtcgacgactcc
gacgatatctcagctcttgggtcagaagaacaaaggtgtatagtaaacgtgtgccagcca
gggaacaacttgttagcagccggctactgtatgtactcgagctcggtcatcttcgttctt
actctaggcaaaggcgttttctccttcacgctcgatccaatgtacggtgagtttgtcctc
acgcaagaaaacattgagatccccaaagccgggagaatctactctttcaacgaagggaat
taccagatgtgggacgataaactaaagaagtacattgatgatcttaaggaccctggtcca
actgggaagccttactccgcaaggtacattggaagtttggttggagattttcacaggact
ttattgtatggtgggatttacgggtaccctcgtgacgcaaagagcaaaaatggaaaactt
aggctgttgtatgagtgtgcaccaatgagtttcattgttgaacaagctggagggaaaggt
tctgatggacattcgagagtactagatatccaaccgactgagatacatcagagggttcct
ctatacattggaagcacagaggaagtagagaagctggagaagtacttggcttga

DBGET integrated database retrieval system