KEGG   Arabidopsis thaliana (thale cress): AT3G54420Help
Entry
AT3G54420         CDS       T00041                                 

Gene name
EP3
Definition
(RefSeq) homolog of carrot EP3-3 chitinase
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00520  Amino sugar and nucleotide sugar metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AT3G54420 (EP3)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     AT3G54420 (EP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_19 Chitin_bind_1
Motif
Other DBs
NCBI-GeneID: 824608
NCBI-ProteinID: NP_191010
MIPS: AT3G54420.1
TAIR: AT3G54420
Araport: AT3G54420
UniProt: Q9M2U5 A0A178VE44
Position
3
AA seq 273 aa AA seqDB search
MLTPTISKSISLVTILLVLQAFSNTTKAQNCGCSSELCCSQFGFCGNTSDYCGVGCQQGP
CFAPPPANGVSVAEIVTQEFFNGIISQAASSCAGNRFYSRGAFLEALDSYSRFGRVGSTD
DSRREIAAFFAHVTHETGHFCYIEEIDGASKDYCDENATQYPCNPNKGYYGRGPIQLSWN
FNYGPAGTAIGFDGLNAPETVATDPVISFKTALWYWTNRVQPVISQGFGATIRAINGALE
CDGANTATVQARVRYYTDYCRQLGVDPGNNLTC
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgttgactcccaccatttctaaatccatctctttagtaaccattctattagttctacaa
gctttctctaacacaacaaaggctcaaaattgcggttgttcgtcagagctatgttgtagt
cagtttggcttttgcggtaacacttcagactattgtggtgtaggttgccaacaaggacct
tgttttgctcctccccctgcaaatggtgtctctgtggctgagattgtaacgcaagaattc
ttcaatggaatcatcagtcaagccgcgtctagttgcgccggcaatagattttacagtcgg
ggagcttttcttgaggccttagactcatattctcgtttcggtagagttggatcgaccgac
gactctaggcgtgagattgcagcgttctttgctcatgtcacacatgaaacaggacatttc
tgctacatagaagagatagacggagcctcaaaggattactgcgacgagaatgcaacacaa
tatccatgcaatcctaacaaaggctactacggccgcggaccgatccaactctcttggaat
ttcaactacgggccagccgggacagcaattggtttcgacggcctgaatgcaccggaaaca
gtagccacggatccagtcatatccttcaaaaccgccttgtggtactggaccaatagggtt
cagcctgttatctctcaaggttttggtgcaacaatccgtgccattaacggtgctttggag
tgtgacggggccaacacagccaccgttcaagctagagttcgttactacacggattattgt
cgtcaacttggcgttgatcctggaaacaacctcacttgctaa

DBGET integrated database retrieval system