KEGG   Arabidopsis thaliana (thale cress): AT3G54970
Entry
AT3G54970         CDS       T00041                                 
Name
(RefSeq) D-aminoacid aminotransferase-like PLP-dependent enzymes superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-GeneID: 824662
NCBI-ProteinID: NP_001326738
TAIR: AT3G54970
UniProt: A0A1I9LQ71
Position
3:complement(20368127..20370131)
AA seq 258 aa
MKRLSSSIRILLKSNPELLFSSGSSPRFWMNQPVPGSSIYDRVNGSMSEALKSVVVKESE
RLYGEELAVTVLVTGNVEKLNRLDVGNNWDFLDVWLHIGAYSPLGPLGVGENAASLALVG
RGRDVAAAKYSDWVRLRKPLEKFRPPLTTELLLSNDGDHLLEGCITNFFVVCRRVKSSEN
LYGGSLSEFEVQTAPITDGVLAGVIRDLVIEVCLSEGIPYRERAPSWSERELWEEAFITS
RSFHIHNLFFHLLAYILA
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaagagactttctagctcgattcgtattcttttgaagtcaaatcccgagcttttgttc
agttctgggtcatcaccgcggttttggatgaatcaaccagttcctggttcgagtatttac
gatcgagtcaatggctctatgagcgaggccctgaagtctgttgttgtcaaggaaagtgaa
agactctatggagaagaattagcagtaactgttcttgttactggtaatgtggagaaattg
aataggttagatgttgggaacaattgggattttctagatgtgtggttgcatataggtgca
tactcgcctttaggcccgttaggtgttggagaaaatgccgcgagtttggctttggttggt
cgtggacgagatgtagctgctgctaaatactcagactgggttaggcttaggaagcctctg
gagaagtttagacctcctttgaccactgaacttcttttgtcaaacgatggtgatcatttg
cttgagggctgcatcacaaactttttcgtagtttgccgcagggtgaagtcatcagagaat
ctctacggcgggagtttgagcgagtttgaggtgcagaccgcgcctataactgatggtgtg
ctagcaggagttataagagaccttgtcatcgaagtgtgtttaagcgaggggattccatac
cgcgagagagcaccttcgtggtctgagcgtgagctttgggaagaagccttcattacaagt
agatctttccatatccataatctgttttttcatcttctcgcatatatattggcctga

DBGET integrated database retrieval system