KEGG   Arabidopsis thaliana (thale cress): AT3G56120Help
Entry
AT3G56120         CDS       T00041                                 

Definition
(RefSeq) S-adenosyl-L-methionine-dependent methyltransferases superfamily protein
  KO
K15429  tRNA (guanine37-N1)-methyltransferase [EC:2.1.1.228]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ath03016]
    AT3G56120
Enzymes [BR:ath01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.228  tRNA (guanine37-N1)-methyltransferase
     AT3G56120
Transfer RNA biogenesis [BR:ath03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    AT3G56120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Met_10 TRM Methyltransf_15 PrmA MethyltransfD12 MTS Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 824778
NCBI-ProteinID: NP_567034
MIPS: AT3G56120.1
TAIR: AT3G56120
Araport: AT3G56120
UniProt: Q93YU6
Position
3
AA seq 468 aa AA seqDB search
MFDESKFDVNLKLWALRIPRELCKSASRILNGYMLNMPRIKPITEDPTCEKTRLVILSES
VKNADLSEIPEEKLNQLKKLSELEVVPHSVTLGYSYWSADHLLKQILPDGLDIPSSFETI
GHIAHLNLHDELLPFKDVIAKVIYDKNYPRIKTIVNKVGTISNEFRVPKFEVLAGENGME
TEVKQYGARFKLDYGLVYWNSRLEHEHMRLSSLFKPGETVCDMFAGIGPFAIPAAQKGCF
VYANDLNPDSVRYLKINAKFNKVDDLICVHNMDARKFFSHLMAVSTCEDNLQSVADNDKT
KEAAVSRGGETNSSGEEIRESNASINEPLGANKKPSGTTKTENGVGKDCKSIEGHANKRL
RQTLLPIAKPWEHIDHVIMNLPASALQFLDSFSNVIQKKYWKGPLPLIHCYCFIRASETT
EFIIAEAETALKFHIEDPVFHKVRDVAPNKAMFCLSFRLPEACLKQEE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgaaagcaagttcgatgtcaatctcaagctctgggctcttagaattccccgt
gaactctgtaaaagcgcatctcgcattctcaatggatacatgcttaacatgccgcgaatt
aagcccatcactgaagatcctacctgtgaaaagactcgtttggtgatattgtccgaaagt
gttaaaaatgctgatttgtcggagatacccgaggaaaaactaaaccagcttaagaaactt
agtgaacttgaggttgttcctcattcggttactcttgggtattcctattggagtgcagac
caccttttgaagcagattctaccagatggattggatataccttcctcttttgaaactata
ggtcatattgcccacttaaatctacatgatgagctccttccattcaaagatgttatagca
aaggttatctacgacaaaaattatccaaggatcaagacaattgttaataaagttgggact
atcagtaatgagtttcgagttccaaagtttgaagtgttagctggagaaaatgggatggaa
acagaagtaaagcaatatggggctagatttaagctggactatggcttggtttattggaat
tcaagattggaacatgagcacatgcggctttcatctttgtttaaacctggggaaaccgta
tgtgatatgtttgctggtattgggccttttgctattccagctgcacagaaaggatgcttt
gtgtatgcaaatgatttaaatccagacagtgttcggtacttgaagatcaatgcaaagttc
aataaggttgatgatttgatttgtgtgcacaacatggatgctcgtaaatttttctctcac
ttgatggcggtgtcaacttgcgaggataatttgcaatcagtggctgataatgataaaaca
aaggaagcagccgtgagtcgaggaggtgagactaattccagtggagaggaaatacgtgaa
tccaatgcaagcataaatgagcctcttggtgcaaataagaagccatctggtactacaaag
acggaaaatggggtaggaaaagactgcaagagtatagaaggacacgcaaataagagattg
agacaaacgttgcttccaatcgcaaagccgtgggaacatatcgaccatgttattatgaac
cttccagcatctgccttgcagtttcttgattcgttcagtaatgttattcaaaagaagtat
tggaaaggacctcttccattaattcattgctattgtttcatccgtgcaagcgaaaccaca
gagtttataattgcagaagctgaaactgctttgaagttccatatagaagatccagtcttc
cacaaggttagagatgttgctccaaacaaggctatgttttgcctaagctttagactacct
gaagcatgcttgaagcaagaagagtaa

DBGET integrated database retrieval system