KEGG   Arabidopsis thaliana (thale cress): AT3G56400Help
Entry
AT3G56400         CDS       T00041                                 

Gene name
WRKY70
Definition
(RefSeq) WRKY DNA-binding protein 70
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: WRKY
Motif
Other DBs
NCBI-GeneID: 824807
NCBI-ProteinID: NP_191199
MIPS: AT3G56400.1
TAIR: AT3G56400
Araport: AT3G56400
UniProt: Q9LY00
Position
3
AA seq 294 aa AA seqDB search
MDTNKAKKLKVMNQLVEGHDLTTQLQQLLSQPGSGLEDLVAKILVCFNNTISVLDTFEPI
SSSSSLAAVEGSQNASCDNDGKFEDSGDSRKRLGPVKGKRGCYKRKKRSETCTIESTILE
DAFSWRKYGQKEILNAKFPRSYFRCTHKYTQGCKATKQVQKVELEPKMFSITYIGNHTCN
TNAETPKSKTCDHHDEIFMDSEDHKSPSLSTSMKEEDNPHRHHGSSTENDLSLVWPEMVF
EEDYHHQASYVNGKTSTSIDVLGSQDLMVFGGGGDFEFSENEHFSIFSSCSNLS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggatactaataaagcaaaaaagcttaaagttatgaaccaactcgttgaaggccatgac
ttaacaactcagcttcagcaactcctctctcaacccgggtccggtctagaggatctagtg
gctaaaatcttagtgtgtttcaataacaccatctccgttcttgataccttcgaacccatc
tcctcctcctcatccctcgccgccgttgagggatctcaaaatgcttcatgtgataacgac
ggcaagtttgaagattccggcgatagtcggaaaagattgggacccgttaagggtaaaaga
ggatgctacaaaagaaaaaagagatcggagacgtgtactatagagtcgactatacttgag
gacgcattttcttggaggaaatatggacaaaaggagattcttaatgccaaattcccaaga
agttactttagatgcacacacaagtatacccaagggtgcaaggcaacaaagcaagtccag
aaggttgagctcgaacccaagatgttcagtatcacatacataggaaaccacacgtgtaac
accaacgcagaaactcccaagagcaagacttgtgaccatcatgatgagatcttcatggat
tccgaagatcacaagagtcctagtttatctacctcaatgaaggaagaagacaatcctcat
cgtcatcatggttcgtccacggagaatgacttgtcattggtgtggccagaaatggttttc
gaagaagattatcatcatcaggccagttacgtcaatgggaaaacgagtacatctatcgat
gttttgggttctcaggatctcatggtgtttggaggtggcggcgatttcgagtttagcgaa
aatgagcacttctctatcttcagttcatgttcgaatctatcttga

DBGET integrated database retrieval system