KEGG   Arabidopsis thaliana (thale cress): AT3G57130Help
Entry
AT3G57130         CDS       T00041                                 

Gene name
BOP1
Definition
(RefSeq) Ankyrin repeat family protein / BTB/POZ domain-containing protein
  KO
K14508  regulatory protein NPR1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    AT3G57130 (BOP1)
Ubiquitin system [BR:ath04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     AT3G57130 (BOP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3420 BTB Ank_2 Ank_5 Ank_3 Ank Ank_4 LA-virus_coat
Motif
Other DBs
NCBI-GeneID: 824880
NCBI-ProteinID: NP_191272
MIPS: AT3G57130.1
TAIR: AT3G57130
Araport: AT3G57130
UniProt: Q9M1I7 A0A178VNE2
Position
3
AA seq 467 aa AA seqDB search
MSNTFEESLKSMSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCESD
PSQPGAEPANQTGSGARAAAVGGVIPVNSVGYEVFLLLLQFLYSGQVSIVPHKHEPRSNC
GDRGCWHTHCTAAVDLSLDILAAARYFGVEQLALLTQKHLTSMVEKASIEDVMKVLIASR
KQDMHQLWTTCSYLIAKSGLPQEILAKHLPIELVAKIEELRLKSSMPLRSLMPHHHDLTS
TLDLEDQKIRRMRRALDSSDVELVKLMVMGEGLNLDESLALIYAVENCSREVVKALLELG
AADVNYPAGPTGKTALHIAAEMVSPDMVAVLLDHHADPNVQTVDGITPLDILRTLTSDFL
FKGAIPGLTHIEPNKLRLCLELVQSAALVISREEGNNNSNDNNTMIYPRMKDEHTSGSSL
DSRLVYLNLGATNRDIGDDNSNQREGMNLHHHHHDPSTMYHHHHHHF
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatactttcgaagaatcactcaaatctatgtcattggattacctaaacctctta
atcaacggtcaagctttctccgatgtcactttcagcgtcgaaggccgtctagtccacgct
caccgttgcatcctcgctgctcgtagcctcttcttccgcaaattcttctgtgaatctgat
ccttcgcaacccggagctgaacccgctaaccaaaccggatcaggagccagagcagccgca
gtaggaggagtcataccggttaactcagtcggttacgaagttttcttacttctacttcaa
ttcttgtacagtggtcaagtctcaattgtaccacataagcacgagccaagatcgaattgt
ggagatagaggatgctggcacacgcattgcactgcagccgtcgatctctctttagatatt
ttagccgccgctcgctactttggcgtcgagcagctcgcgttgcttactcagaaacatttg
acaagtatggtggagaaagcctccattgaagatgtgatgaaagtgctcatagcttcaaga
aagcaagacatgcatcaattatggactacttgctcttacttaatcgccaaatccggtctt
ccacaagagattctagccaaacatctcccaatcgaacttgtagccaagattgaggagctc
cgtctcaaatcttcaatgcctctccgttcactaatgcctcaccaccatgacctaacctcg
actttagacctcgaagaccagaagatcaggaggatgagacgtgcattggactcctctgat
gtcgagcttgtgaagctaatggtgatgggagaaggactcaatctagatgagtccctagct
ttgatttacgcggttgaaaattgtagtagagaggttgtaaaggcacttcttgagcttgga
gcagctgatgtgaactatcccgcgggtcccacagggaaaaccgctcttcacattgcggct
gaaatggtgtctccggacatggtggctgttttactcgaccaccacgccgaccctaacgtc
cagacagtggatggaatcactcctctcgacatccttcgaaccctaacgtcagattttttg
ttcaagggggcaattcctggattgactcacattgagcccaataagcttaggctttgtctc
gagctggtccagtccgcggcattggttatatcacgcgaagaaggaaacaataacagtaac
gataacaacacaatgatctaccctaggatgaaagacgaacacacgagcggaagtagtttg
gattcaagattggtttatctgaatcttggtgctacaaatcgtgatattggagatgacaat
agcaatcaaagggaaggaatgaatctgcatcatcatcatcatgacccatcaacgatgtat
catcaccaccaccaccatttctag

DBGET integrated database retrieval system