KEGG   Arabidopsis thaliana (thale cress): AT3G57470Help
Entry
AT3G57470         CDS       T00041                                 

Definition
(RefSeq) Insulinase (Peptidase family M16) family protein
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ath01002]
    AT3G57470
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     AT3G57470
Peptidases and inhibitors [BR:ath01002]
 Metallo peptidases
  Family M16: pitrilysin family
   AT3G57470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C HSBP1
Motif
Other DBs
NCBI-GeneID: 824914
NCBI-ProteinID: NP_001319782
MIPS: AT3G57470.1
TAIR: AT3G57470
Araport: AT3G57470
UniProt: F4J3D9
Position
3
AA seq 966 aa AA seqDB search
MAVGMENATASGECGEILKPRTDKREYRRIVLKNSLEVLLISDPETDKCAASMNVSVGSF
TDPEGLEGLAHFLEHMLFYASEKYPEEDSYSKYITEHGGSTNAYTSSEDTNYHFDINTDS
FYEALDRFAQFFIQPLMSTDATMREIKAVDSEHQNNLLSDSWRMAQLQKHLSREDHPYHK
FSTGNMDTLHVRPEENGVDTRSELIKFYDEHYSANIMHLVVYGKENLDKTQGLVEALFQG
IRNTNQGIPRFPGQPCTLDHLQVLVKAVPIMQGHELSVSWPVTPSISHYEEAPCRYLGDL
IGHEGEGSLFHALKILGWATGLYAGEADWSMEYSFFNVSIDLTDAGHEHMQDILGLLFEY
IKVLQQSGVSQWIFDELSAICEAEFHYQAKIDPISYAVDISSNMKIYPTKHWLVGSSLPS
KFNPAIVQKVLDELSPNNVRIFWESNKFEGQTDKVEPWYNTAYSLEKITKFTIQEWMQSA
PDVNLLLPTPNVFIPTDFSLKDLKDKDIFPVLLRKTSYSRLWYKPDTKFFKPKAYVKMDF
NCPLAVSSPDAAVLSDIFVWLLVDYLNEYAYYAQAAGLDYGLSLSDNGFELSLAGFNHKL
RILLEAVIQKIAKFEVKPDRFSVIKETVTKAYQNNKFQQPHEQATNYCSLVLQDQIWPWT
EELDALSHLEAEDLANFVPMLLSRTFVECYIAGNVEKDEAESMVKHIEDVLFTDSKPICR
PLFPSQFLTNRVTELGTGMKHFYYQEGSNSSDENSALVHYIQVHKDEFSMNSKLQLFELI
AKQDTFHQLRTIEQLGYITSLSLSNDSGVYGVQFIIQSSVKGPGHIDSRVESLLKDLESK
FYNMSDEEFKSNVTNLIDMKLEKDKNLDEESWFYWAEIQTGTLKFNRIDAEVAALRLLKK
DEWIDFFDEYIKVDAPNKKSLSICVYGNQHLKEMRNDKDKIPSTSIEIEDIVCFRKSQPL
YGSLKL
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggcggttggaatggagaacgcgacggcgtctggtgaatgtggcgagatacttaagcca
cgcaccgacaagagagagtatcggaggattgttctgaagaattcgctggaggtgttgtta
atcagcgacccagagactgacaagtgtgctgcttcaatgaacgttagcgttggatcgttt
acggacccagaaggattggaagggctagctcatttccttgagcatatgctgttttatgca
agtgaaaaataccctgaggaagatagttactccaagtacatcacagagcatggagggagc
acaaatgcttatacttccagtgaagatacaaactaccatttcgatatcaacactgattct
ttttatgaagctttggacaggtttgcacagttctttatccagccactgatgtcaactgat
gccaccatgagggagatcaaggcggtcgactctgagcatcagaataacttgttgtctgac
tcttggcgtatggcccagttacagaagcatctaagtagagaagaccatccatatcacaaa
tttagcacagggaatatggatactcttcacgtacgacccgaagaaaatggagtggataca
aggagtgaactaattaaattttatgacgaacactattctgccaacatcatgcatctggtt
gtttatggcaaggaaaatcttgataaaactcaaggtctagtggaagcgttgttccaggga
attcgaaacaccaaccagggtattccaagatttcctggtcagccgtgtactctagaccat
ttgcaggttctcgtgaaggctgttcctataatgcagggtcacgagcttagtgtttcatgg
cctgtaactcctagcatctctcattatgaagaggcaccatgcaggtatcttggtgatcta
attggtcatgaaggcgaaggaagtctgtttcatgccttaaaaatcttgggttgggcaaca
ggactctatgctggtgaagcagactggagtatggaatattctttcttcaatgtttcaatt
gatcttactgatgctggtcatgagcatatgcaagatattttagggttgttgttcgaatac
attaaggttttacaacagtctggtgtttcccagtggatttttgatgagctctcagctata
tgtgaggcagaatttcattatcaagccaaaatagatccaatttcttatgcagtggatatt
tcttcaaacatgaagatatatccaaccaagcattggctggtaggatcatcactgccttcg
aaatttaatccagctattgtgcaaaaggttctcgatgagctttctcccaataatgttcga
atcttttgggagtcaaataaatttgaagggcaaactgacaaggttgagccatggtataac
actgcttattcacttgagaagataaccaaattcaccattcaggagtggatgcagtcagcc
cctgatgtaaacctgcttctaccaacacctaatgtcttcattcctacggatttttcatta
aaggatttaaaggataaggatatctttcctgttttgctgagaaagacatcatactcaaga
ttgtggtataagcctgacacaaagttcttcaaaccaaaggcatacgttaagatggatttt
aactgcccccttgcagtcagctctcccgacgctgcggttctttcagatatttttgtttgg
ttgctagtggactatttgaatgaatatgcttattatgctcaggctgctggtcttgactat
ggattaagtctttcggacaatggctttgagctctctcttgctggctttaatcacaaattg
aggatcttgctggaagctgtcattcaaaagatagcaaaattcgaagttaaacctgacagg
ttttccgttatcaaggaaacagtcacaaaggcataccaaaataacaaattccaacaacca
catgaacaagcaacgaattactgctcactagtattacaagatcagatttggccttggaca
gaggaactagatgctctttctcatttggaagctgaagacttggctaatttcgttccgatg
ctattatcaaggacatttgttgagtgctatatagcagggaatgttgagaaggacgaagct
gagtcaatggtcaagcatattgaagatgttctttttaccgactcaaaacctatttgtcgt
ccgttatttccatcccagttcctgacaaatagggttacagagctcggaacaggaatgaaa
cacttttactatcaggaaggttcaaactccagtgatgaaaattctgccctagtgcattat
attcaggttcataaagatgagttttccatgaatagtaaacttcagcttttcgaactaatt
gcaaaacaagacacgtttcaccagcttagaacgattgagcaacttggctacatcacctca
ctttctctgagcaacgattctggcgtctatggtgtacaattcattatccagtcttcagtt
aagggtccaggacatattgattcgagagttgagtcactactaaaggacctggagagtaaa
ttttacaatatgagcgatgaagaattcaagagcaatgtaacaaatttgatagatatgaag
cttgaaaaggacaagaacttggatgaggaatcctggttttactgggcagagattcaaacc
gggacactcaaattcaaccgcatagatgcagaggtggctgcactgagactgctaaagaag
gacgaatggatagatttctttgacgaatacataaaggttgacgcaccaaataagaaatcg
ttgagcatatgcgtttacggaaaccaacatttgaaggaaatgcgaaatgacaaagacaag
attccatcaacatccatagaaatcgaagacattgtctgtttcagaaagtctcaacctctt
tacgggtcgttgaaactatga

DBGET integrated database retrieval system