KEGG   Arabidopsis thaliana (thale cress): AT3G58970
Entry
AT3G58970         CDS       T00041                                 

Symbol
MGT6
Name
(RefSeq) magnesium transporter 6
  KO
K16075  magnesium transporter
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT3G58970 (MGT6)
Transporters [BR:ath02000]
 Other transporters
  Pores ion channels [TC:1]
   AT3G58970 (MGT6)
SSDB
Motif
Pfam: CorA DUF4006 DUF5798
Other DBs
NCBI-GeneID: 825066
NCBI-ProteinID: NP_567076
TAIR: AT3G58970
UniProt: Q93ZD7 A0A178VB54
Position
3:complement(21789332..21791476)
AA seq 436 aa
MGKGPLSFRRLSSIRHRKKGSAVKDDSAQTSTPSSPPPPLPIHAGGSAVGATGKAKKKTG
GARLWMRFDRTGAMEVVECDKSTIIKRASVPARDLRILGPVFSHSSNILAREKAIVVNLE
VIKAIVTAEEVLLLDPLRPEVLPFVERLKQQFPQRNGNENALQASANVQSPLDPEAAEGL
QSELPFEFQVLEIALEVVCSFVDKSVAALETEAWPVLDELTKNVSTENLEYVRSLKSNLT
RLLARVQKVRDELEHLLDDNEDMADLYLTRKWIQNQQTEAILAGTASNSIALPAHNTSNL
HRLTSNRSASMVTSNTEEDDVEDLEMLLEAYFMQLDGMRNKILTVREYIDDTEDYVNIQL
DNQRNELIQLQLTLTIASFAIAAETLLASLFGMNIPCPLYSIHGVFGYFVWSVTALCIVL
FMVTLGYARWKKLLGS
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggggaagggccccttatcgtttcgccgtctttcaagcatccgtcaccggaaaaaaggt
tctgcggtgaaggatgactccgcacagacatcgacgccttcatctccaccgcctccccta
ccgattcatgctggcggatcggctgtgggagcgacggggaaggcgaagaagaaaaccgga
ggagctaggctgtggatgaggtttgatcggactggtgctatggaagtggtggagtgcgat
aagagtacaatcatcaaacgtgcttctgttcccgctagggatttgaggatacttggccct
gtcttctctcactcctctaacattctcgccagagagaaagctattgttgtgaatttagag
gtcataaaggcaatagttactgcagaagaagtgttgttgttggatcctctccgtcctgaa
gttcttccattcgttgaacgactaaagcaacagtttcctcagaggaatgggaatgaaaat
gcactgcaagcttctgcgaatgtacaatctcctcttgatccagaagctgcagagggtttg
cagagtgagcttccttttgagtttcaggtcctggagattgcacttgaggtcgtctgctca
tttgttgataaaagtgtggctgctcttgagacagaagcttggcctgtccttgatgaactc
actaagaatgtcagcactgagaatcttgaatatgtacgaagtttgaaaagtaatctcacc
cgcttgctagctcgtgtacaaaaggtgagagatgaactcgagcatttgttagatgacaac
gaagacatggctgacttatacttaacaaggaaatggatccagaaccagcaaaccgaggca
atactggcgggtacagcatcaaacagcattgccctcccagcacataatacatcaaatctt
caccggctcacatcaaacagaagtgcgagtatggtgacgagcaatacagaggaagatgac
gtggaggatttggagatgttgttggaggcatacttcatgcaactggatggaatgcggaac
aagattcttacagtgagggagtacattgacgacacagaagactacgtgaacattcaactg
gataatcaacgaaacgaactgatccagctgcagctgacgctgaccatagcctcgtttgca
atagccgcagagacattgttggccagcttgtttggaatgaacataccatgtccattgtat
agcatacatggcgtctttggttactttgtgtggagtgttactgcactttgcattgtgctt
ttcatggtcactcttggttacgccaggtggaagaagctgctaggctcataa

DBGET integrated database retrieval system