KEGG   Arabidopsis thaliana (thale cress): AT3G59420
Entry
AT3G59420         CDS       T00041                                 

Symbol
CR4
Name
(RefSeq) crinkly4
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RCC1_2 TNFR_c6 APH ABC1
Other DBs
NCBI-GeneID: 825111
NCBI-ProteinID: NP_191501
TAIR: AT3G59420
UniProt: Q9LX29 A0A654FJ74
Position
3:complement(21959646..21963180)
AA seq 895 aa
MRMFETRAREWILLVKLVLFTSIWQLASALGSMSSIAISYGEGGSVFCGLKSDGSHLVVC
YGSNSAILYGTPGHLQFIGLTGGDGFMCGLLMLSHQPYCWGNSAFIQMGVPQPMTKGAEY
LEVSAGDYHLCGLRKPIVGRRKNSNIISSSLVDCWGYNMTRNFVFDKQLHSLSAGSEFNC
ALSSKDKSVFCWGDENSSQVISLIPKEKKFQKIAAGGYHVCGILDGLESRVLCWGKSLEF
EEEVTGTSTEEKILDLPPKEPLLAVVGGKFYACGIKRYDHSAVCWGFFVNRSTPAPTGIG
FYDLAAGNYFTCGVLTGTSMSPVCWGLGFPASIPLAVSPGLCIDTPCPPGTHELSNQENS
PCKFTGSHICLPCSTSCPPGMYQKSVCTERSDQVCVYNCSSCSSHDCSSNCSSSATSGGK
EKGKFWSLQLPIATAEIGFALFLVAVVSITAALYIRYRLRNCRCSENDTRSSKDSAFTKD
NGKIRPDLDELQKRRRARVFTYEELEKAADGFKEESIVGKGSFSCVYKGVLRDGTTVAVK
RAIMSSDKQKNSNEFRTELDLLSRLNHAHLLSLLGYCEECGERLLVYEFMAHGSLHNHLH
GKNKALKEQLDWVKRVTIAVQAARGIEYLHGYACPPVIHRDIKSSNILIDEEHNARVADF
GLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLTTKSDVYSFGVLLLEILSGRKAIDM
HYEEGNIVEWAVPLIKAGDINALLDPVLKHPSEIEALKRIVSVACKCVRMRGKDRPSMDK
VTTALERALAQLMGNPSSEQPILPTEVVLGSSRMHKKSWRIGSKRSGSENTEFRGGSWIT
FPSVTSSQRRKSSASEGDVAEEEDEGRKQQEALRSLEEEIGPASPGQSLFLHHNF
NT seq 2688 nt   +upstreamnt  +downstreamnt
atgagaatgttcgaaacgagagcaagggaatggattctccttgtaaagcttgtgcttttc
actagtatatggcagcttgcttcagctcttggttcaatgtcttcaattgcaatttcttat
ggagaaggtggttctgtattctgtggtctgaagtctgatgggtctcatcttgtggtttgc
tacggatcgaactcagcaatcctctatgggactcctggtcatctccagttcatcggttta
acgggtggagatgggtttatgtgtgggcttctgatgctatctcatcagccttattgttgg
ggaaacagtgcatttattcaaatgggagttcctcaaccaatgaccaaaggagctgagtat
ttagaagttagtgctggtgattaccatctttgtggtttgaggaagccaatagtgggaaga
agaaagaacagcaacattatttcctcttctcttgttgattgttggggttacaatatgaca
agaaactttgtctttgataagcagttacattcgctttcggctggttcggagttcaactgc
gcgctgtcctctaaagataagtcggttttctgttggggagatgagaatagtagtcaagta
atcagtttaatccccaaggaaaaaaagtttcagaaaattgcagctggtggataccatgtt
tgtggcattcttgacgggttggaatcgcgagtgctatgttggggaaagagcttagagttc
gaagaggaggttacagggacttctacagaagaaaagattcttgatttaccaccaaaagag
ccactcttagcagtggtaggtgggaagttttatgcttgtggaatcaaacgctatgatcat
agtgcggtctgttggggttttttcgtgaacaggagtacacctgctcctacaggtatcggc
ttttatgatcttgcagcggggaattacttcacttgcggagttctcacagggacttctatg
tcacctgtttgttggggtcttggtttccctgcttctatccctttagctgtctcaccagga
ctctgtatagacactccttgtccaccaggaactcatgaactcagtaaccaagaaaactcg
ccttgcaaatttactggctctcacatttgcttgccctgtagcaccagttgccctcctgga
atgtatcagaaaagcgtatgcacagagagatctgatcaagtttgtgtttacaactgctcc
agttgttcctcacatgattgctcctcaaactgctcttcttcggctaccagtggaggcaag
gaaaaaggaaagttttggtcactgcagctacctattgcaactgcagagattggatttgct
ctatttttggtagcggttgtctcgataacagcggctttatacattaggtacagattgagg
aattgtaggtgctcagaaaatgatacaaggtcttctaaagattcagcctttacgaaagat
aatggcaaaatccgtccggatcttgatgagctgcaaaagcgcagaagggctagagttttc
acttatgaggaacttgaaaaagccgctgatggattcaaagaagaatcaatagtggggaaa
gggagtttctcatgtgtgtacaaaggagtactgagagatggaaccactgttgcagtgaag
agagcgataatgtcatcagacaaacagaagaattcaaatgagtttcgcacggagcttgat
ctgttatcaagactcaaccatgctcatcttcttagccttcttggatactgtgaagaatgt
ggagaaaggcttttagtttatgagtttatggcacacggctcactgcacaaccatcttcat
ggaaagaacaaggccttgaaagagcaactagattgggtcaaaagagtaacgattgctgtc
caagctgctagaggaatcgaatacttgcatggttacgcttgccctcccgtgattcaccgg
gatattaaatcatcaaacattcttatagatgaagaacacaatgctcgagtagctgatttt
ggtctctccttacttggtcctgtcgatagcggctctcctttggcagaactaccagcagga
actctcggttaccttgatcccgagtactatcgacttcactatctcacaaccaaatccgat
gtctacagctttggagtcctgcttctcgagatcctaagcggaagaaaagccattgacatg
cactacgaagaagggaacatagtagaatgggcagttcctttgatcaaagcaggagatata
aacgcactcttggacccggtcttgaaacatccatctgaaatcgaagctttgaaaagaatc
gtgagtgtggcttgcaaatgcgtgagaatgagagggaaagatagaccatcaatggataaa
gtgacaacagcattggaacgagcgcttgcacagctaatgggaaacccgagcagtgagcag
ccaatattaccaacagaagtggttcttgggagcagcagaatgcacaagaagtcatggagg
atcggttcaaaaaggtctggttccgagaacacggaattcagaggcggatcatggataaca
ttcccgagcgtgacatcatcgcagaggaggaaatcatcggcatctgaaggagatgtcgca
gaggaggaggatgaagggaggaagcaacaagaagcattgaggagtcttgaggaagagata
gggccagcttctcctggacagagcttgttcttgcatcataatttctga

DBGET integrated database retrieval system