KEGG   Arabidopsis thaliana (thale cress): AT3G59960
Entry
AT3G59960         CDS       T00041                                 

Gene name
ASHH4
Definition
(RefSeq) histone-lysine N-methyltransferase ASHH4
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: SET AWS DUF682 DUF6376
Other DBs
NCBI-GeneID: 825166
NCBI-ProteinID: NP_001319802
MIPS: AT3G59960.1
TAIR: AT3G59960
UniProt: A0A2H1ZEL3
Position
3
AA seq 329 aa
MSSSKKGSDRNQIRKSLRKLKKQIGELEKLESPDRLNNVKPIFIKRNIYLKKKLKKKVKD
HGIFCSCSLDPGSSTLCGSDCNCGILLSSCSSSCKCSSECTNKPFQQRHIKKMKLVQTEK
CGYGIVADEDINSGEFIIEYVGEVIDDKICEERLWKLNHKVETNFYLCQINWNMVIDATH
KGNKSRYINHSCSPNTEMQKWIIDGETRIGIFATRFINKGEQLTYDYQFVQFGADQDCYC
GAVCCRKKLGAKPCKTKNTTLEEAVKPVACKVTWKTPKGKTRGRRIAGQAWNNHSQRKIC
CRDCIGAVIWLARPMNQKCFGIITQYDEF
NT seq 990 nt   +upstreamnt  +downstreamnt
atgtcttcctcgaagaagggttccgatcggaatcaaatcaggaagtcgttgaggaagtta
aaaaagcagattggggaattggagaaacttgaatctccggatcggttgaataatgtgaag
cctatcttcatcaagcgcaatatatacttgaagaagaaactcaagaagaaagttaaggat
catggcatattctgttcttgctccttggatcctggttcttcaactctttgtggcagcgat
tgcaattgtgggattctactctcaagctgttcgtctagttgcaaatgcagtagtgaatgc
accaacaagccgttccaacaacgacatatcaagaagatgaagttagttcagacagagaaa
tgtggatatgggattgtagcagatgaagatatcaactcaggagagtttatcattgaatat
gtgggagaagttattgacgacaagatttgtgaagaaaggctttggaagctgaatcataag
gtcgagacaaatttctatttgtgtcagataaactggaacatggtgattgatgctactcac
aagggtaataaatcaagatacatcaatcacagctgcagtcctaacacagagatgcagaaa
tggataattgatggcgagacaagaatcggcatttttgctacccgtttcataaacaaaggc
gagcagttgacttacgattaccagtttgttcagtttggtgcagatcaagattgctactgt
ggtgcagtgtgttgcagaaaaaagctaggtgcaaaaccttgcaaaactaagaacacaacc
ttagaagaagctgtgaagccagtggcatgtaaagtgacctggaaaacgcccaagggaaaa
actcgagggagacgcattgctggacaagcttggaacaatcatagccagaggaaaatatgt
tgccgggactgcattggtgcggtgatctggttagcacgtcccatgaaccaaaagtgtttt
ggaatcattacacaatatgatgagttttaa

DBGET integrated database retrieval system