KEGG   Arabidopsis thaliana (thale cress): AT3G60750
Entry
AT3G60750         CDS       T00041                                 
Name
(RefSeq) Transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00030  Pentose phosphate pathway
ath00710  Carbon fixation by Calvin cycle
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ath_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
ath_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ath_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AT3G60750
  09102 Energy metabolism
   00710 Carbon fixation by Calvin cycle
    AT3G60750
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    AT3G60750
Enzymes [BR:ath01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     AT3G60750
SSDB
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh XFP_C YbeY
Other DBs
NCBI-GeneID: 825246
NCBI-ProteinID: NP_567103
TAIR: AT3G60750
UniProt: Q8RWV0 A0A178VEI0
Position
3:22453668..22457458
AA seq 741 aa
MASTSSLALSQALLARAISHHGSDQRGSLPAFSGLKSTGSRASASSRRRIAQSMTKNRSL
RPLVRAAAVETVEPTTDSSIVDKSVNSIRFLAIDAVEKAKSGHPGLPMGCAPMAHILYDE
VMRYNPKNPYWFNRDRFVLSAGHGCMLLYALLHLAGYDSVQEEDLKQFRQWGSKTPGHPE
NFETPGIEVTTGPLGQGIANAVGLALAEKHLAARFNKPDAEVVDHYTYAILGDGCQMEGI
SNEACSLAGHWGLGKLIAFYDDNHISIDGDTEIAFTENVDQRFEALGWHVIWVKNGNTGY
DEIRAAIKEAKTVTDKPTLIKVTTTIGYGSPNKANSYSVHGAALGEKEVEATRNNLGWPY
EPFQVPDDVKSHWSRHTPEGATLESDWSAKFAAYEKKYPEEASELKSIITGELPAGWEKA
LPTYTPESPGDATRNLSQQCLNALAKVVPGFLGGSADLASSNMTLLKAFGDFQKATPEER
NLRFGVREHGMGAICNGIALHSPGLIPYCATFFVFTDYMRGAMRISALSEAGVIYVMTHD
SIGLGEDGPTHQPIEHIASFRAMPNTLMFRPADGNETAGAYKIAVTKRKTPSILALSRQK
LPHLPGTSIEGVEKGGYTISDDSSGNKPDVILIGTGSELEIAAQAAEVLRKDGKTVRVVS
FVCWELFDEQSDEYKESVLPSDVSARVSIEAASTFGWGKIVGGKGKSIGINSFGASAPAP
LLYKEFGITVEAVVDAAKSFF
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggcttctacttcttccctcgctctctctcaagctctcctagctcgtgcaatctctcac
catggttctgaccaacgtggatctttaccagctttctctggactcaaatccaccggttca
cgcgcctcagcttcgtctcgtcgacgtatcgctcaatccatgaccaaaaaccgatctctc
cgtcctcttgttcgcgctgcagctgttgagactgttgagccaaccactgattcgtcgatt
gtggacaaatcggtcaactcgattaggtttttggctatcgatgcggtggagaaggccaaa
tcaggtcatcctggtcttcctatgggttgtgctccgatggctcacattttgtatgatgag
gtcatgaggtataaccccaagaacccttattggttcaaccgtgaccgattcgttctatct
gctggacatggatgtatgttgctctacgcgttgcttcatcttgccggctacgacagcgtc
caggaggaagatttgaagcagttccgtcaatggggaagcaagacaccaggacatcctgag
aatttcgagactcctggaattgaagtcactactggtcctcttggacaaggaatcgctaat
gctgttggtttagctcttgctgagaagcatttggctgctagattcaacaaacctgatgct
gaagtagtcgaccactacacatatgcgatccttggagatggttgtcagatggagggtatt
tctaatgaagcttgctctctagctggccattggggacttggaaagctcattgctttctac
gatgacaatcacatttctatagatggagacacagaaattgccttcactgagaacgtggac
cagcgatttgaagcccttggatggcatgttatctgggtgaagaatggaaacactgggtat
gacgagatccgtgctgccattaaggaagctaaaactgttactgacaagcctactttgatc
aaggtcactactaccattggttatgggtctcccaacaaggcgaactcatacagtgtccat
ggagctgcacttggcgagaaggaagttgaggctaccagaaataaccttggatggccgtat
gagccgttccaggtacctgacgatgtaaaaagccactggagtcgtcatacacctgaagga
gctactcttgaatctgactggagtgcaaagtttgcagcatatgaaaagaagtacccagag
gaagcttctgagttgaaatctattatcactggtgaattacctgctggctgggagaaggct
ctacctacatacacaccagagtctccaggtgatgccaccagaaacctgtcacagcaatgt
cttaacgcccttgctaaagttgttcccggtttccttggtggaagtgctgaccttgcatca
tccaacatgacattgctgaaagcctttggcgacttccaaaaggccacacctgaagaaaga
aatcttaggtttggtgttagggagcacggaatgggagccatctgcaatggcattgccctt
cacagccccggtcttatcccttactgtgcgacgttctttgtcttcaccgactacatgaga
ggtgccatgagaatctcagctttgtctgaagctggtgttatctatgttatgacccatgat
tccattggtcttggagaagatggaccaacccatcagcccattgagcacattgcaagtttc
cgtgctatgcccaacactcttatgttccgtcctgctgatggaaatgaaacagccggtgca
tacaagatcgctgtcaccaagcgcaagacaccatctatcttagctctgtctaggcaaaag
ctgcctcatcttccaggtacatccatcgaaggagtggaaaagggtggatatacaatttct
gacgactcttcaggcaacaaacccgatgtgatcttgattggaactggttctgagctagag
attgctgcacaggctgcggaggtgctcaggaaagacggcaaaaccgttagagttgtttct
ttcgtgtgctgggaactatttgacgagcaatcagatgaatacaaggagagtgtgttgcca
tcggatgtatcagctagagttagcattgaagcagcttcgactttcggatggggaaagatt
gttggaggcaaaggaaagtccattggtattaattcattcggagccagcgcaccagcaccc
ttactctacaaggagtttggtatcaccgttgaagctgttgttgatgcggccaagtcattc
ttctaa

DBGET integrated database retrieval system