KEGG   Arabidopsis thaliana (thale cress): AT3G60820Help
Entry
AT3G60820         CDS       T00041                                 

Gene name
PBF1
Definition
(RefSeq) N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein
  KO
K02732  20S proteasome subunit beta 6 [EC:3.4.25.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03050  Proteasome
Module
ath_M00340  Proteasome, 20S core particle
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    AT3G60820 (PBF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ath01002]
    AT3G60820 (PBF1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ath03051]
    AT3G60820 (PBF1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     AT3G60820 (PBF1)
Peptidases [BR:ath01002]
 Threonine Peptidases
  Family T1: proteasome family
   AT3G60820 (PBF1)
Proteasome [BR:ath03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    AT3G60820 (PBF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome Mga L27
Motif
Other DBs
NCBI-GeneID: 825253
NCBI-ProteinID: NP_001190146
MIPS: AT3G60820.1
TAIR: AT3G60820
Araport: AT3G60820
UniProt: P42742 A0A178V6R9
Position
3
AA seq 223 aa AA seqDB search
MTKQHANWSPYDNNGGTCVAIAGSDYCVIAADTRMSTGYSILSRDYSKIHKLADRAVLSS
SGFQADVKALQKVLKSRHLIYQHQHNKQMSCPAMAQLLSNTLYFKRFFPYYAFNVLGGLD
EEGKGCVFTYDAVGSYERVGYGAQGSGSTLIMPFLDNQLKSPSPLLLPKQDSNTPLSEAE
AVDLVKTVFASATERDIYTGDKLEIMILKADGIKTELMDLRKD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacagcacgcgaactggtctccttacgataacaatggaggaacatgtgtggcc
atcgctggatcggattactgtgttatcgccgccgatactcggatgtctactggttacagt
attcttagtcgcgattactccaaaatccataaactagcggacagagctgttttgtcttcc
tctggcttccaggctgatgtgaaagctttgcagaaggttctcaaatccagacacttgatc
tatcaacatcagcataacaagcagatgagctgtcctgcaatggcccagcttctctccaac
acgctttatttcaagcggtttttcccctactatgcctttaatgttctaggagggcttgac
gaggaaggaaaagggtgtgtctttacttacgacgctgttggctcatacgagagagttgga
tacggtgctcaaggttctggttccacactcatcatgcctttccttgacaatcagctcaag
tctccaagtcctcttttgctacctaaacaggattcaaacacgcccctttccgaagctgaa
gcagttgacttggttaaaactgttttcgcatctgccacagagagggatatctacactgga
gacaagcttgagattatgatacttaaggccgacggtatcaagaccgaactcatggacctg
aggaaagactaa

DBGET integrated database retrieval system