KEGG   Arabidopsis thaliana (thale cress): AT3G61800
Entry
AT3G61800         CDS       T00041                                 
Name
(RefSeq) ENTH/VHS protein
  KO
K23720  UV-stimulated scaffold protein A
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    AT3G61800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT3G61800
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Other TCR factor
      AT3G61800
SSDB
Motif
Pfam: UVSSA_N DUF2043 VHS
Other DBs
NCBI-GeneID: 825353
NCBI-ProteinID: NP_001326668
TAIR: AT3G61800
Position
3:complement(22874363..22878667)
AA seq 664 aa
MEGRDDGGGKVIGLIEKATKSTAQEVDPRLLKAIKSIVRYSDSEVRLSSQTLMELMRHNH
SQVRYLTLFIIDELFMRSKLFRTLIIENLDQLLSLSIGFRSNLPLPAPPAVATTLRSKAI
EFLEKWNLSFGFHYKELRLGFDYLKNTLKLKFPDLQANAARIQRERQEREMKTKEILRNK
FDSLRVSFGLFKYEIEVTIKEIKECMEIVQWRGDDGVPLAILDEEDFEEIRCSHLRQIRL
DSLKQSEKVEETGENRIVFDVLREQCKLLVTKHLISVQEGISLLIRVDVSDNRTRDSMLK
DLIDIRNNILAAKKKWEEAGFTMSRMTDIHGNEETNEEEEDIWEEDDGKVKTDSVKNVAH
VMRTQQSENSSLPSSGEAKKSTSEARSNKVSNTKKVGSSGNSLRDKLISEAPVMNWGSQL
TNWESTTEVRANYRGLEIESHWGRVDQDAIIPADKIAELNLQATVYREERTETPPCRASL
KKGGLCQRRDLRVCPFHGPIVPRDDEGNTIIQESPLDESENQTSSTSGTNQDVSMDETTS
DSDPNQLARQIAKEALKNIREKDKEVVRKRAKLVKVKVKEHNHEVLRGAAIASTSRSNAM
DDEFDRVFAEKKNKKQTFSTRRKKTTAKDRISQRLFSNRVKGTNPQQLAQGNDEKCRDTS
ANQW
NT seq 1995 nt   +upstreamnt  +downstreamnt
atggaaggaagagatgacggcggagggaaagttattgggttgatagagaaagcgacgaaa
tcaactgctcaagaggttgacccgaggcttctcaaggcgatcaaatccattgttcgctat
tctgattcggaggtccgacttagttcgcaaaccctaatggagctcatgagacataaccac
tctcaggttcgatatctgacgcttttcataatcgacgagctattcatgagatcaaagctc
tttagaactttgataattgagaatcttgatcagcttttgagtttaagtattgggtttaga
agcaatctgcctcttcctgcaccacctgctgttgccactacgttgcgttcaaaggctatt
gagttcttggagaagtggaatttgtcttttgggtttcattacaaggagcttagacttggg
tttgattaccttaagaataccctcaagttaaagttccctgatttacaggctaatgctgca
cggattcaacgagagagacaggagagggagatgaagacaaaagagattttgcggaacaag
tttgattccttgagagttagttttggactcttcaagtatgagattgaggtaacgataaag
gaaatcaaggagtgtatggaaattgttcagtggagaggggatgatggtgttccacttgcg
atcttagatgaggaagattttgaggagatccgttgttctcatctgaggcaaattcgtctt
gattcactgaaacaatcagaaaaggttgaagaaactggtgaaaacagaattgtatttgat
gtgttgagggaacagtgcaagcttctagtgacaaagcatctgatctcggttcaagaaggg
atctctcttctcattagggttgacgtaagtgataacagaacgagagattccatgttgaag
gacttgattgatatcaggaataacatattggcagctaaaaagaaatgggaagaagctggt
tttacaatgtcaagaatgactgatattcacggtaatgaagaaacaaacgaggaagaagaa
gatatctgggaggaggatgatggcaaggttaaaactgattcagtcaagaacgtggctcat
gtgatgagaactcagcagagtgagaattcatctttaccatcatcaggtgaagcaaagaag
tctacatcagaagctaggtccaataaagtgtcgaacactaaaaaagttggaagcagtgga
aactctcttagagacaagctaatttctgaagcgcctgtgatgaattggggatcacagttg
actaattgggaatcaactacggaagttcgagctaattaccggggtttagagatcgagagc
cactggggcagggtggatcaagatgctataattccagcagataaaatagcagaattgaat
cttcaggcaaccgtgtatagagaagagagaacagagacacctccatgccgtgcttctcta
aagaaaggtggtctttgccagagaagagatctcagagtctgtccgtttcacggacccatt
gtaccccgggatgatgaaggaaacaccataatccaggaatctccattagatgagagtgaa
aaccaaacttcttcaacttcagggaccaaccaggatgtgtctatggatgaaacaacttca
gattctgatcctaatcagttagctaggcaaatagcgaaagaggctctgaagaatatccgg
gagaaagacaaagaagtggtgaggaaaagagcaaagcttgttaaggttaaggttaaggaa
cacaatcatgaagttctgcgtggtgcggcaatagcctcaacttctagatcgaatgctatg
gatgatgagtttgatagagtttttgctgaaaagaaaaacaagaagcaaaccttttccaca
aggcgtaagaaaacaacggctaaagatagaatatcccagagactgtttagtaatcgagta
aaaggtactaatccacagcagttggctcagggcaatgatgaaaagtgccgggatacatcg
gctaaccagtggtaa

DBGET integrated database retrieval system