KEGG   Arabidopsis thaliana (thale cress): AT3G62790
Entry
AT3G62790         CDS       T00041                                 

Definition
(RefSeq) NADH-ubiquinone oxidoreductase-like protein
  KO
K03938  NADH dehydrogenase (ubiquinone) Fe-S protein 5
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00190  Oxidative phosphorylation
ath01100  Metabolic pathways
Module
ath_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AT3G62790
SSDB
Motif
Pfam: Ndufs5 DUF6499 PAN_3 CHCH
Other DBs
NCBI-GeneID: 825454
NCBI-ProteinID: NP_191838
MIPS: AT3G62790.1
TAIR: AT3G62790
UniProt: Q9LZI6 A0A178VCL7
Position
3
AA seq 83 aa
MASGWGITGNKGRCYDFWMDFSECMSHCREPKDCTLLREDYLECLHHSKEFQRRNRIYKE
EQRKLRAASRKGEETGDGTHTHH
NT seq 252 nt   +upstreamnt  +downstreamnt
atggcgtcggggtgggggataacgggaaacaaagggaggtgttacgatttctggatggat
ttcagcgaatgtatgtctcattgcagagagcccaaagactgtactcttcttcgtgaagac
tacctcgagtgtcttcaccattccaaagagttccaacgaagaaacaggatatacaaagaa
gaacaacgtaaactaagagctgcatcaaggaaaggcgaagaaaccggggatgggactcat
actcatcactag

DBGET integrated database retrieval system