KEGG   Arabidopsis thaliana (thale cress): AT3G63370Help
Entry
AT3G63370         CDS       T00041                                 

Gene name
OTP86
Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR PPR_2 DYW_deaminase PPR_1 PPR_3 PPR_long
Motif
Other DBs
NCBI-GeneID: 825512
NCBI-ProteinID: NP_001319827
MIPS: AT3G63370.1
TAIR: AT3G63370
Araport: AT3G63370
UniProt: Q9M1V3
Position
3
AA seq 960 aa AA seqDB search
MEYAVTNMRLLSNMMYSASAISFPRVRLHCSIPTEPSCRRNPFRQSNQPVQVPSPKLACF
DGVLTEAFQRLDVSENNSPVEAFAYVLELCGKRRAVSQGRQLHSRIFKTFPSFELDFLAG
KLVFMYGKCGSLDDAEKVFDEMPDRTAFAWNTMIGAYVSNGEPASALALYWNMRVEGVPL
GLSSFPALLKACAKLRDIRSGSELHSLLVKLGYHSTGFIVNALVSMYAKNDDLSAARRLF
DGFQEKGDAVLWNSILSSYSTSGKSLETLELFREMHMTGPAPNSYTIVSALTACDGFSYA
KLGKEIHASVLKSSTHSSELYVCNALIAMYTRCGKMPQAERILRQMNNADVVTWNSLIKG
YVQNLMYKEALEFFSDMIAAGHKSDEVSMTSIIAASGRLSNLLAGMELHAYVIKHGWDSN
LQVGNTLIDMYSKCNLTCYMGRAFLRMHDKDLISWTTVIAGYAQNDCHVEALELFRDVAK
KRMEIDEMILGSILRASSVLKSMLIVKEIHCHILRKGLLDTVIQNELVDVYGKCRNMGYA
TRVFESIKGKDVVSWTSMISSSALNGNESEAVELFRRMVETGLSADSVALLCILSAAASL
SALNKGREIHCYLLRKGFCLEGSIAVAVVDMYACCGDLQSAKAVFDRIERKGLLQYTSMI
NAYGMHGCGKAAVELFDKMRHENVSPDHISFLALLYACSHAGLLDEGRGFLKIMEHEYEL
EPWPEHYVCLVDMLGRANCVVEAFEFVKMMKTEPTAEVWCALLAACRSHSEKEIGEIAAQ
RLLELEPKNPGNLVLVSNVFAEQGRWNDVEKVRAKMKASGMEKHPGCSWIEMDGKVHKFT
ARDKSHPESKEIYEKLSEVTRKLEREVGYVADTKFVLHNVDEGEKVQMLHGHSERIAIAY
GLLRTPDRACLRITKNLRVCRDCHTFCKLVSKLFRRDIVMRDANRFHHFESGLCSCGDSW
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atggaatacgcggtaactaacatgagactactgagtaacatgatgtactctgcttcggcg
atttcgtttccaagggttcgtctgcattgtagtattccgacagagccatcctgccggaga
aacccattccgacagagcaatcagcccgtccaagtcccttctccgaagctcgcttgtttc
gacggagtcctaactgaagcttttcaacggctggacgtcagcgaaaacaactctccagtc
gaagcctttgcctacgttctcgagctttgtggtaaacgtagagctgtctcacaaggtcgg
cagctgcattcgcgcattttcaagactttcccctctttcgaattagattttttggccggc
aagcttgtttttatgtacggtaagtgcgggtctctggatgacgcagagaaagtgtttgac
gaaatgcctgacagaactgcctttgcgtggaataccatgattggagcttatgtttcgaat
ggtgaacctgcttccgctcttgctctctactggaatatgcgtgtggagggcgttcctctc
ggtctttcctcttttcccgccttgcttaaagcctgcgccaaacttagagatatccgaagt
ggctctgagcttcattctctcctcgttaaacttggctaccattcaactggttttatcgtc
aatgcgttggtttccatgtatgctaagaacgatgaccttagcgctgcaaggcgtctgttt
gacggattccaagagaaaggagatgctgttctctggaattctattttgtcttcatattcc
acgtctgggaaatctctcgagactttagaattattcagagaaatgcacatgactggccct
gcccccaacagctacaccattgtttctgctctcacagcctgtgacggtttttcatatgca
aagctagggaaagagatccacgcttctgtcctcaaatcatcaactcactcttctgaatta
tatgtgtgcaacgccttgattgcaatgtataccaggtgtggtaaaatgcctcaggcagaa
aggatccttcgtcagatgaataacgctgatgttgtcacatggaattctctgattaaggga
tatgtacagaatctcatgtacaaggaggctttagagttcttttctgatatgatcgctgct
ggccacaaatccgacgaggtttcaatgaccagcatcattgcagcgtcaggaagattaagc
aatctcttggcaggaatggaattgcacgcttacgtgattaaacatggctgggattctaat
ttgcaggttgggaatacgttgattgatatgtattcaaagtgcaacctcacatgttacatg
ggccgtgcgtttcttaggatgcatgacaaagatcttatttcatggactacggtcattgcc
ggttatgcccagaatgattgtcatgtagaggccttagaactcttccgggatgttgctaag
aaaaggatggagattgatgaaatgatcctgggaagcatccttcgagcttctagtgtactg
aaatccatgctcattgtcaaagaaatccattgtcacattttgagaaaaggtttacttgat
actgtgatacagaatgagttggtagatgtctacggaaaatgcaggaacatgggctatgct
actcgagtatttgaatcaattaaaggtaaagatgttgtctcttggacaagcatgatttcg
tctagtgctcttaatggtaatgaaagcgaggctgttgaactctttcgacgcatggttgaa
actggtttgtcagctgattctgtagcattgttgtgtatactgtcagctgcagcaagttta
tctgcactcaataaagggagagaaattcattgctacttactccgaaaggggttttgccta
gaggggtccattgcagttgcagttgttgacatgtatgcatgctgtggagatttacagagt
gcaaaggctgtatttgaccggatagaaaggaaaggtttgctgcaatacacaagtatgatc
aatgcatatggaatgcatggctgcggaaaagcagctgttgagttgttcgataaaatgagg
cacgaaaacgtctcgcccgatcacatttcatttctggcacttctttatgcgtgcagccat
gcaggtctgcttgacgagggtagagggtttctcaagatcatggaacatgagtatgaattg
gaaccatggcctgaacattacgtgtgtctggttgacatgctgggtcgtgcaaattgtgta
gtggaagcctttgaattcgttaaaatgatgaaaacagaaccgactgcagaagtctggtgt
gcactccttgcggcatgccgatctcactcagagaaagaaattggagagattgctgctcag
aggctccttgagctagaacctaagaatccgggaaatcttgtgcttgtatctaatgtcttt
gctgaacaaggaagatggaacgatgtagaaaaagtgagggcaaaaatgaaagcaagtgga
atggagaaacaccctggatgtagttggattgagatggacggcaaggttcataaatttaca
gccagagacaagtctcacccagagagcaaagagatatatgagaaattgtccgaggttact
aggaagttggagagggaagtaggttatgtagccgatacaaagttcgttctgcataatgta
gatgaaggggagaaggttcagatgctgcatggacatagtgagaggatagcgattgcttat
ggtctgctcagaacacctgaccgagcctgtctacggatcacaaaaaatttacgtgtctgt
agagattgccatactttttgtaagctggtctctaaattattcagacgagacattgtgatg
agggatgccaatagatttcatcattttgaaagtggactgtgttcttgcggagattcttgg
tga

DBGET integrated database retrieval system