KEGG   Arabidopsis thaliana (thale cress): AT4G00840Help
Entry
AT4G00840         CDS       T00041                                 

Definition
(RefSeq) DHHC-type zinc finger family protein
  KO
K20028  palmitoyltransferase ZDHHC2/15/20 [EC:2.3.1.225]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT4G00840
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     AT4G00840
Membrane trafficking [BR:ath04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    AT4G00840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 826193
NCBI-ProteinID: NP_567193
MIPS: AT4G00840.1
TAIR: AT4G00840
Araport: AT4G00840
UniProt: Q5M757
Position
4
AA seq 291 aa AA seqDB search
MNLFRFCSGLKVLGYFMILLVVAVVGVSYYAVVVSTWWPILIRGDHGALSALAALIIFVF
HFLLIMLLWSYFTTVFTDPGSVPEHFRREMGGGDSLEAGTSTDQGAFGSLGYCTKCRNVK
PPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTFLETMLDVIVLLPSFIE
FFSQAIKHSSSPGKLASLVLAFVLNFAFVLSLLCFVVMHISLLSSNTTSVEVHEKNGEVR
WKYDLGKKKNFEQVFGKKKAFWLLPLYSKDDIDNITSLEGLEFPTCSDIDP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttttccggttctgctccggtctgaaagtcctcggctatttcatgatccttctt
gtcgtcgccgtcgttggtgtatcttactacgccgtcgtagttagcacatggtggccgatc
ttgatccgcggagaccatggagctttatccgccctcgctgccttaatcatctttgttttc
catttcctgctgataatgctgttgtggagctacttcacaacagtttttacagacccaggt
tctgttcctgagcatttcagaagagaaatgggaggtggtgacagtttggaggctggtact
tcgacagatcaaggagcttttggctctttaggttactgtaccaaatgccggaatgttaag
ccgcctcgttgccatcattgttctgtgtgtcaaagatgtgttcttaagatggatcatcat
tgtgtttggattgtaaactgtgttggagcacgcaattacaagtttttccttctctttctg
ttctatacttttcttgagacaatgttggatgttattgtcttgcttcctagtttcattgaa
ttcttcagccaagctataaagcattcttcttctccgggtaaactggcctctctcgttctg
gcattcgttcttaactttgcgttcgttctcagccttctttgtttcgtagtcatgcatatt
tctcttctctcatccaacactacttcagttgaggttcatgagaaaaatggagaagtcaga
tggaaatatgacttaggaaagaagaaaaacttcgagcaggtttttgggaagaagaaggcg
ttttggctcctcccattgtactctaaagacgatatcgataacataacttcccttgaaggc
cttgaatttccaacttgttctgacatcgacccttga

DBGET integrated database retrieval system